1. Recombinant Proteins
  2. Others
  3. Doublecortin/DCX Protein, Human (His)

Doublecortin/DCX Protein, a microtubule-associated protein, is vital for early stages of neuronal dispersion and cortex lamination during cerebral cortex development. It may compete with the neuronal protein kinase DCLK1 in binding to a target protein, contributing to crucial signaling pathways involved in neuronal interaction and migration. DCX interacts with tubulin and USP9X. Doublecortin/DCX Protein, Human (His) is the recombinant human-derived Doublecortin/DCX protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Doublecortin/DCX Protein, a microtubule-associated protein, is vital for early stages of neuronal dispersion and cortex lamination during cerebral cortex development. It may compete with the neuronal protein kinase DCLK1 in binding to a target protein, contributing to crucial signaling pathways involved in neuronal interaction and migration. DCX interacts with tubulin and USP9X. Doublecortin/DCX Protein, Human (His) is the recombinant human-derived Doublecortin/DCX protein, expressed by E. coli , with N-GST labeled tag.

Background

The Doublecortin/DCX Protein plays a pivotal role as a microtubule-associated protein in the early stages of neuronal dispersion and cortex lamination during cerebral cortex development. Its function may involve competing with the putative neuronal protein kinase DCLK1 for binding to a target protein, thereby participating in a crucial signaling pathway essential for neuronal interaction before and during migration. This process is likely part of a calcium ion-dependent signal transduction pathway. Doublecortin/DCX may also collaborate with PAFAH1B1/LIS-1, contributing to overlapping yet distinct signaling pathways that collectively promote efficient neuronal migration. In this intricate cellular orchestration, Doublecortin/DCX interacts with tubulin and USP9X, emphasizing its involvement in the regulation of microtubule dynamics and highlighting its significance in the complex molecular pathways governing neuronal development.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

O43602-2 (A45-V150)

Gene ID
Molecular Construction
N-term
GST
DCX (A45-V150)
Accession # O43602-2
C-term
Protein Length

Partial

Synonyms
Neuronal migration protein doublecortin; Doublin; Lis-X; DCX
AA Sequence

ALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNV

Molecular Weight

Approximately 13 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Doublecortin/DCX Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Doublecortin/DCX Protein, Human (His)
Cat. No.:
HY-P75282
Quantity:
MCE Japan Authorized Agent: