1. Recombinant Proteins
  2. Others
  3. DNAJC30 Protein, Human (His)

DNAJC30 is a neuron-enriched mitochondrial protein that plays a critical regulatory role in mitochondrial respiration. It binds to the ATP synthase complex and promotes ATP synthesis. DNAJC30 Protein, Human (His) is the recombinant human-derived DNAJC30 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DNAJC30 is a neuron-enriched mitochondrial protein that plays a critical regulatory role in mitochondrial respiration. It binds to the ATP synthase complex and promotes ATP synthesis. DNAJC30 Protein, Human (His) is the recombinant human-derived DNAJC30 protein, expressed by E. coli , with N-His labeled tag.

Background

DNAJC30, a mitochondrial protein enriched in neurons, assumes a crucial role as a regulator of mitochondrial respiration. This protein associates with the ATP synthase complex, playing a facilitative role in ATP synthesis. Additionally, it acts as a potential chaperone involved in the turnover of the subunits of mitochondrial complex I N-module, contributing to the degradation of N-module subunits damaged by oxidative stress and thereby enhancing the functional efficiency of complex I. Notably, DNAJC30's interaction with MT-ATP6 and ATP5MC2, both direct, underscores its involvement in these mitochondrial processes, shedding light on its significance in maintaining mitochondrial function and cellular homeostasis.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q96LL9 (S39-G124)

Gene ID
Molecular Construction
N-term
His
DNAJC30 (S39-G124)
Accession # Q96LL9
C-term
Protein Length

Partial

Synonyms
DnaJ homolog subfamily C member 30; WBSCR18
AA Sequence

SQGDCSYSRTALYDLLGVPSTATQAQIKAAYYRQCFLYHPDRNSGSAEAAERFTRISQAYVVLGSATLRRKYDRGLLSDEDLRGPG

Molecular Weight

Approximately 14 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

DNAJC30 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DNAJC30 Protein, Human (His)
Cat. No.:
HY-P76873
Quantity:
MCE Japan Authorized Agent: