1. Recombinant Proteins
  2. Others
  3. Der p 23 Protein, Dermatophagoides pteronyssinus (HEK293, His)

Der p 23 Protein, Dermatophagoides pteronyssinus (HEK293, His)

Cat. No.: HY-P75289
Handling Instructions Technical Support

The Der p 23 protein was identified as a member of the allergic house dust mite proteins and does not exhibit chitin-binding ability in vitro. This unique feature distinguishes Der p 23 from other proteins known for their affinity to chitin, emphasizing its unique properties. Der p 23 Protein, Dermatophagoides pteronyssinus (HEK293, His) is the recombinant Der p 23 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Der p 23 protein was identified as a member of the allergic house dust mite proteins and does not exhibit chitin-binding ability in vitro. This unique feature distinguishes Der p 23 from other proteins known for their affinity to chitin, emphasizing its unique properties. Der p 23 Protein, Dermatophagoides pteronyssinus (HEK293, His) is the recombinant Der p 23 protein, expressed by HEK293 , with C-His labeled tag.

Background

Der p 23 protein, as indicated by available information, does not exhibit chitin-binding activity in vitro. Chitin is a polysaccharide often associated with the exoskeletons of insects and the cell walls of fungi, and the absence of chitin binding in Der p 23 suggests a unique functional profile. Additionally, Der p 23 is described as a monomeric protein, implying that it exists as a single, independent unit rather than forming complexes with other molecules. Understanding these characteristics is crucial for unraveling the biological role of Der p 23, particularly in the context of its interactions with environmental factors, and further research is needed to delineate the specific functions and implications of this protein within relevant physiological contexts. (

Species

Others

Source

HEK293

Tag

C-His

Accession

L7N6F8 (A22-T90)

Gene ID

113788516  [NCBI]

Molecular Construction
N-term
DEP23 (A22-T90)
Accession # L7N6F8
His
C-term
Synonyms
Major mite allergen Der p 23; Peritrophin-like protein Der p 23; Der p 23
AA Sequence

ANDNDDDPTTTVHPTTTEQPDDKFECPSRFGYFADPKDPHKFYICSNWEAVHKDCPGNTRWNEDEETCT

Molecular Weight

Approximately 19 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Der p 23 Protein, Dermatophagoides pteronyssinus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Der p 23 Protein, Dermatophagoides pteronyssinus (HEK293, His)
Cat. No.:
HY-P75289
Quantity:
MCE Japan Authorized Agent: