1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. DDOST Protein, Human

DDOST is a key subunit of the oligosaccharyltransferase (OST) complex, which catalyzes the initial glycan transfer during protein N-glycosylation. This co-translational process begins with the transfer of defined glycans to asparagine residues in the nascent polypeptide chain. DDOST Protein, Human is the recombinant human-derived DDOST protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DDOST is a key subunit of the oligosaccharyltransferase (OST) complex, which catalyzes the initial glycan transfer during protein N-glycosylation. This co-translational process begins with the transfer of defined glycans to asparagine residues in the nascent polypeptide chain. DDOST Protein, Human is the recombinant human-derived DDOST protein, expressed by E. coli , with tag free.

Background

DDOST, a subunit of the oligosaccharyl transferase (OST) complex, plays a pivotal role in catalyzing the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This marks the crucial commencement of protein N-glycosylation, a cotranslational process. The OST complex, where DDOST is a vital component, associates with the Sec61 complex at the translocon complex, facilitating protein translocation across the endoplasmic reticulum (ER). The maximal enzyme activity of the OST complex requires the presence of all subunits. Additionally, DDOST is indispensable for the assembly of both SST3A- and SS3B-containing OST complexes. In essence, DDOST's involvement in protein modification, particularly protein glycosylation, underscores its essential role in initiating the intricate process of N-glycosylation, contributing to the structural and functional diversity of glycoproteins.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P39656-1 (S43-P427)

Gene ID
Molecular Construction
N-term
DDOST (S43-P427)
Accession # P39656
C-term
Protein Length

Lumenal Domain

Synonyms
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit; DDOST; KIAA0115; OST48
AA Sequence

SGPRTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYP

Molecular Weight

Approximately 44 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, pH 8.0, 8% trehalose, 0.02% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

DDOST Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DDOST Protein, Human
Cat. No.:
HY-P75701
Quantity:
MCE Japan Authorized Agent: