1. Recombinant Proteins
  2. Others
  3. DCBLD2 Protein, Human (HEK293, His)

DCBLD2 Protein is a novel platelet membrane receptor that recruits TRAF6 through EGFR phosphorylation and stimulates AKT to promote tumorigenesis. The DCBLD2 Protein has multiple functions during development as well as in vascular and tumor biology, such as influencing cell proliferation and tumorigenesis. DCBLD2 Protein, Human (HEK293, His) is the recombinant human-derived DCBLD2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DCBLD2 Protein is a novel platelet membrane receptor that recruits TRAF6 through EGFR phosphorylation and stimulates AKT to promote tumorigenesis. The DCBLD2 Protein has multiple functions during development as well as in vascular and tumor biology, such as influencing cell proliferation and tumorigenesis. DCBLD2 Protein, Human (HEK293, His) is the recombinant human-derived DCBLD2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

DCBLD2 encodes discoid, CUB, and LCCL domain protein 2, also known as endothelial and smooth muscle cell-derived neuropilin-like protein (ESDN) and/or Charcot-Leyden crystalloprotein pseudogene 1 (CLCP1). The DCBLD2 gene is a type I transmembrane receptor that has structural similarities to neuropilin-like transmembrane scaffold receptors, such as vascular endothelial growth factor (VEGF) receptors and signaling proteins, and has multiple functions in developmental processes as well as in vascular and tumor biology. DCBLD2 is a novel platelet membrane receptor that plays a key role in vascular remodeling, influencing vascular smooth muscle cell (VSMC) proliferation, cell movement and metastasis in some cancers, and neuronal localization. DCBLD2 recruits TRAF6 through EGFR phosphorylation and stimulates AKT to promote tumorigenesis[1][2][3][4][5].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q96PD2-1 (Q67-A528)

Gene ID
Molecular Construction
N-term
DCBLD2 (Q67-A528)
Accession # Q96PD2-1
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
rHuDiscoidin, CUB and LCCL domain-containing protein 2/ DCBLD2, His; Discoidin; CUB and LCCL domain-containing protein 2; DCBLD2; CUB; LCCL and coagulation factor V/VIII-homology domains protein 1; Endothelial and smooth muscle cell-derived neuropilin-like protein; DCBLD2; CLCP1; ESDN;
AA Sequence

QQGDGCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNEITLLFMSGIHVSGRGFLASYSVIDKQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQENSWKPKKARLKKPGPPWAAFATDEYQWLQIDLNKEKKITGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYHQDVRNNFLPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTAPPKIAKGRAPKFTQPLQPRSSNEFPAQTEQTTASPDIRNTTVTPNVTKDVA

Molecular Weight

80-110 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

DCBLD2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DCBLD2 Protein, Human (HEK293, His)
Cat. No.:
HY-P70095
Quantity:
MCE Japan Authorized Agent: