1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Endothelial cell CD Proteins
  4. DC-SIGN1/CD209 DC-SIGN1/CD209
  5. DC-SIGN/CD209 Protein, Human (HEK293, Fc)

The DC-SIGN/CD209 protein is expressed on immature dendritic cells (DC) and is an important pathogen recognition receptor that initiates primary immune responses. It mediates endocytosis and subsequent degradation of pathogens within the lysosomal compartment. DC-SIGN/CD209 Protein, Human (HEK293, Fc) is the recombinant human-derived DC-SIGN/CD209 protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The DC-SIGN/CD209 protein is expressed on immature dendritic cells (DC) and is an important pathogen recognition receptor that initiates primary immune responses. It mediates endocytosis and subsequent degradation of pathogens within the lysosomal compartment. DC-SIGN/CD209 Protein, Human (HEK293, Fc) is the recombinant human-derived DC-SIGN/CD209 protein, expressed by HEK293 , with N-hFc labeled tag.

Background

DC-SIGN/CD209 Protein, expressed on the surface of immature dendritic cells (DCs), serves as a pivotal pathogen-recognition receptor, playing a crucial role in initiating the primary immune response. This receptor is implicated in the endocytosis of pathogens, leading to their subsequent degradation within lysosomal compartments. Following this process, DC-SIGN returns to the cell membrane surface, presenting pathogen-derived antigens to resting T-cells through MHC class II proteins, thereby triggering the adaptive immune response. On DCs, it acts as a high-affinity receptor for ICAM2 and ICAM3, binding to mannose-like carbohydrates. Notably, DC-SIGN may function as a DC rolling receptor, facilitating the transendothelial migration of DC precursors from the bloodstream to tissues by interacting with endothelial ICAM2. Furthermore, it appears to modulate DC-induced T-cell proliferation through its binding to ICAM3 on T-cells within the immunological synapse formed between DCs and T-cells.

Biological Activity

Measured by its ability of the immobilized protein to support the adhesion of CHO Chinese hamster ovary cells transfected with ICAM-3. The ED50 for this effect is 1.087 μg/mL, corresponding to a specific activity is 919.963 units/mg.

  • Measured by its ability of the immobilized protein to support the adhesion of CHO Chinese hamster ovary cells transfected with ICAM-3. The ED50 for this effect is 1.087 μg/mL, corresponding to a specific activity is 919.963 units/mg.
Species

Human

Source

HEK293

Tag

N-hFc

Accession

Q9NNX6-1 (Q59-A404)

Gene ID
Molecular Construction
N-term
hFc
CD209 (Q59-A404)
Accession # Q9NNX6-1
C-term
Protein Length

Extracellular Domain

Synonyms
rHuCD209 antigen/CD209, Fc; CD209 molecule; CD209; CDSIGNHIV gpl20-binding protein; CLEC4L; DCSIGN; DC-SIGN; DC-SIGN1; CD209 Antigen
AA Sequence

QVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA

Molecular Weight

Approximately 78 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

DC-SIGN/CD209 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DC-SIGN/CD209 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P70110
Quantity:
MCE Japan Authorized Agent: