1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors Cystatin Family
  4. Cystatin F
  5. Cystatin F/CST7 Protein, Mouse (HEK293, His)

Cystatin F/CST7 Protein inhibits papain and cathepsin L, showing lower affinities compared to other cystatins. Notably, its distinct feature is its potential role in immune regulation, inhibiting a unique target within the hematopoietic system. This specialization implies Cystatin F/CST7's involvement in modulating immune responses within the complex regulatory network of hematopoiesis. Cystatin F/CST7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cystatin F/CST7 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cystatin F/CST7 Protein inhibits papain and cathepsin L, showing lower affinities compared to other cystatins. Notably, its distinct feature is its potential role in immune regulation, inhibiting a unique target within the hematopoietic system. This specialization implies Cystatin F/CST7's involvement in modulating immune responses within the complex regulatory network of hematopoiesis. Cystatin F/CST7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cystatin F/CST7 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Cystatin F/CST7 protein serves as an inhibitor of papain and cathepsin L, albeit with affinities lower than other cystatins. Its distinctive feature lies in its potential role in immune regulation, where it acts by inhibiting a unique target within the hematopoietic system. This suggests that Cystatin F/CST7 may play a specialized role in modulating immune responses, contributing to the intricate regulatory network governing proteolytic activities in the context of hematopoiesis.

Biological Activity

Measured by its ability to inhibit active Cathepsin L cleavage of 10µM fluorogenic peptidesubstrate Z-LR-AMC (HY-142021) that incubate at room temperature in kinetic mode for 5 minutes. The IC50 value is 2.833 nM.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

O89098 (A19-Q144)

Gene ID
Molecular Construction
N-term
CST7 (A19-Q144)
Accession # O89098
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rMuCystatin-F/CST7, His; Cystatin-F; Cystatin-like Metastasis-Associated Protein; Leukocystatin; CMAP; Cystatin-7; Cst7;
AA Sequence

ARPPDFCSKDLISSVKPGFPKTIETNNPGVLKAARHSVEKFNNCTNDIFLFKESHVSKALVQVVKGLKYMLEVKIGRTTCRKTMHHQLDNCDFQTNPALKRTLYCYSEVWVIPWLHSFEVPVLLCQ

Molecular Weight

Approximately 18.0-19.1 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Cystatin F/CST7 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cystatin F/CST7 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P7853
Quantity:
MCE Japan Authorized Agent: