1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. CYP102A1 Protein, Priestia megaterium (P. pastoris, His)

CYP102A1 Protein, Priestia megaterium (P. pastoris, His)

Cat. No.: HY-P700629
Handling Instructions Technical Support

The CYP102A1 protein acts as a fatty acid monooxygenase, catalyzing the hydroxylation of fatty acids at various positions. The protein also exhibits NADPH-dependent reductase activity, promoting electron transfer within its domain. CYP102A1 Protein, Priestia megaterium (P. pastoris, His) is the recombinant CYP102A1 protein, expressed by P. pastoris , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CYP102A1 protein acts as a fatty acid monooxygenase, catalyzing the hydroxylation of fatty acids at various positions. The protein also exhibits NADPH-dependent reductase activity, promoting electron transfer within its domain. CYP102A1 Protein, Priestia megaterium (P. pastoris, His) is the recombinant CYP102A1 protein, expressed by P. pastoris , with C-6*His labeled tag.

Background

CYP102A1, known as a fatty acid monooxygenase, exhibits versatile enzymatic activities contributing to its role in diverse metabolic processes. This protein catalyzes the hydroxylation of fatty acids at various omega positions, including omega-1, omega-2, and omega-3, with a particular preference for medium and long-chain fatty acids such as lauric, myristic, and palmitic acids. Additionally, CYP102A1 can metabolize some primary fatty acid metabolites into secondary and tertiary products. Notably, it displays a marginal activity towards short-chain fatty acids. Its ability to hydroxylate highly branched fatty acids is crucial for regulating membrane fluidity. Beyond its monooxygenase function, CYP102A1 demonstrates a NADPH-dependent reductase activity in the C-terminal domain, facilitating electron transfer to the heme iron of the cytochrome P450 N-terminal domain. An intriguing aspect of its functionality involves the inactivation of quorum sensing signals produced by competing bacteria. CYP102A1 efficiently oxidizes acyl homoserine lactones (AHLs), key molecules in quorum sensing signaling pathways, and their lactonolysis products acyl homoserines (AHs), thus contributing to the modulation of bacterial communication.

Species

Others

Source

P. pastoris

Tag

C-6*His

Accession

P14779 (T2-R472)

Gene ID

/

Molecular Construction
N-term
CYP102A1 (T2-R472)
Accession # P14779
6*His
C-term
Protein Length

Partial

Synonyms
Bifunctional cytochrome P450; NADPH--P450 reductase; Cytochrome P450BM-3; Fatty acid monooxygenase; Flavocytochrome P450 BM3
AA Sequence

TIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPSPSTEQSAKKVR

Molecular Weight

55.2 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CYP102A1 Protein, Priestia megaterium (P. pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CYP102A1 Protein, Priestia megaterium (P. pastoris, His)
Cat. No.:
HY-P700629
Quantity:
MCE Japan Authorized Agent: