1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins
  4. Cyclin-Dependent Kinases (CDKs)
  5. Cyclin-Dependent Kinase 5 (CDK5)
  6. CDK5 Protein, Human (P.pastoris, His)

CDK5 is a proline-directed serine/threonine protein kinase that critically regulates neuronal cell cycle, differentiation and potential apoptosis in neuronal diseases by preventing cell cycle re-entry. It interacts with numerous proteins involved in neuronal development and coordinates processes such as survival, migration, differentiation, axonal growth, synaptogenesis, and neurotransmission. CDK5 Protein, Human (P.pastoris, His) is the recombinant human-derived CDK5 protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CDK5 is a proline-directed serine/threonine protein kinase that critically regulates neuronal cell cycle, differentiation and potential apoptosis in neuronal diseases by preventing cell cycle re-entry. It interacts with numerous proteins involved in neuronal development and coordinates processes such as survival, migration, differentiation, axonal growth, synaptogenesis, and neurotransmission. CDK5 Protein, Human (P.pastoris, His) is the recombinant human-derived CDK5 protein, expressed by P. pastoris , with N-His labeled tag.

Background

CDK5, a proline-directed serine/threonine-protein kinase, stands as an essential player in neuronal cell cycle regulation, differentiation, and the potential induction of apoptotic cell death in neuronal diseases by instigating abortive cell cycle re-entry. Its interactions span a spectrum, engaging with proteins like D1 and D3-type G1 cyclins, SRC, NOS3, VIM/vimentin, p35/CDK5R1, MEF2A, SIPA1L1, SH3GLB1, PXN, PAK1, MCAM/MUC18, SEPT5, SYN1, DNM1, AMPH, SYNJ1, CDK16, RAC1, RHOA, CDC42, TONEBP/NFAT5, MAPT/TAU, MAP1B, histone H1, p53/TP53, HDAC1, APEX1, PTK2/FAK1, huntingtin/HTT, ATM, MAP2, NEFH, and NEFM. Functionally, CDK5 orchestrates critical processes in neuronal development, including survival, migration, differentiation, axonal and neurite growth, synaptogenesis, oligodendrocyte differentiation, synaptic plasticity, and neurotransmission, achieved by phosphorylating key proteins. Additionally, it negatively regulates the CACNA1B/CAV2.2-mediated Ca(2+) release probability at hippocampal neuronal soma and synaptic terminals. In the mature central nervous system, CDK5 plays a pivotal role in neurotransmitter movements and cell survival, activating anti-apoptotic proteins BCL2 and STAT3 while negatively regulating JNK3/MAPK10 activity. Its multifaceted functions encompass the intricate regulation of various cellular processes, including DNA damage response, Wnt/beta-catenin signaling, and the GAIT pathway. Moreover, CDK5 impacts dendritic spine morphogenesis and participates in circadian clock regulation by modulating CLOCK protein function.

Biological Activity

Measured in a cell proliferation assay using HuH-7 cells. The ED50 for this effect is 2.516 ng/mL.

  • Measured in a cell proliferation assay using HuH-7 cells. The ED50 for this effect is 2.516 ng/mL, corresponding to a specific activity is 3.97×105 units/mg.
Species

Human

Source

P. pastoris

Tag

N-His

Accession

Q00535 (M1-P292)

Gene ID
Molecular Construction
N-term
His
CDK5 (M1-P292)
Accession # Q00535
C-term
Protein Length

Full Length

Synonyms
Cdk5; Cell division protein kinase 5; Protein kinase CDK5 splicing; PSSALRE
AA Sequence

MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP

Molecular Weight

Approximately 38.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1.0 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CDK5 Protein, Human (P.pastoris, His)
Cat. No.:
HY-P72298
Quantity:
MCE Japan Authorized Agent: