1. Recombinant Proteins
  2. Others
  3. Cyclin A1 Protein, Human (sf9, His)

Cyclin A1 protein is a key regulator in the cell cycle, affecting G1/S and G2/M transitions and playing a major role in the germline meiotic cell cycle. It interacts with CDK2 and CDC2 kinase to form a holoenzyme complex that participates in the regulatory pathways of E2F-1 and RB proteins. Cyclin A1 Protein, Human (sf9, His) is the recombinant human-derived Cyclin A1 protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cyclin A1 protein is a key regulator in the cell cycle, affecting G1/S and G2/M transitions and playing a major role in the germline meiotic cell cycle. It interacts with CDK2 and CDC2 kinase to form a holoenzyme complex that participates in the regulatory pathways of E2F-1 and RB proteins. Cyclin A1 Protein, Human (sf9, His) is the recombinant human-derived Cyclin A1 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

Cyclin A1 Protein emerges as a pivotal regulator in the intricate control of the cell cycle, exerting influence at the G1/S (start) and G2/M (mitosis) transitions. Its role extends beyond somatic cells, as it appears to be primarily involved in governing the germline meiotic cell cycle, with additional functions in the mitotic cell cycle of certain somatic cells. Through interactions with CDK2 and CDC2 protein kinases, Cyclin A1 forms a serine/threonine kinase holoenzyme complex, where the cyclin subunit confers substrate specificity. Notably, it does not bind CDK4 and CDK5 in vitro. The Cyclin A1-CDK2 complex interacts with transcription factor E2F-1 and RB proteins, underscoring its involvement in crucial regulatory pathways. Furthermore, it participates in complexes with CDK2, CABLES1, and CCNE1, indicating its multifaceted interactions within the cell cycle regulatory network. Interactions with INCA1 and KLHDC9 further highlight the intricate molecular associations that contribute to Cyclin A1's role in cell cycle regulation. Unraveling the specific mechanisms governing Cyclin A1's interactions and functions could provide valuable insights into its regulatory impact on both meiotic and mitotic cell cycles.

Species

Human

Source

Sf9 insect cells

Tag

N-His

Accession

P78396 (M1-Q465)

Gene ID
Molecular Construction
N-term
His
Cyclin A1 (M1-Q465)
Accession # P78396
C-term
Synonyms
CCNA1; Cyclin A1; cyclin-A1
AA Sequence

METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ

Molecular Weight

Approximately 50 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Cyclin A1 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cyclin A1 Protein, Human (sf9, His)
Cat. No.:
HY-P72962
Quantity:
MCE Japan Authorized Agent: