1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. CYB5R1 Protein, Human (His)

CYB5R1 is an important member of the NADH-cytochrome b5 reductase family and plays a crucial role in fatty acid desaturation, cholesterol biosynthesis, drug metabolism, and erythrocyte methemoglobin reduction. Utilizing NADH, CYB5R1 promotes the reduction of cytochrome b5, contributing to enzymatic processes in lipid metabolism, sterol synthesis, and drug biotransformation. CYB5R1 Protein, Human (His) is the recombinant human-derived CYB5R1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CYB5R1 is an important member of the NADH-cytochrome b5 reductase family and plays a crucial role in fatty acid desaturation, cholesterol biosynthesis, drug metabolism, and erythrocyte methemoglobin reduction. Utilizing NADH, CYB5R1 promotes the reduction of cytochrome b5, contributing to enzymatic processes in lipid metabolism, sterol synthesis, and drug biotransformation. CYB5R1 Protein, Human (His) is the recombinant human-derived CYB5R1 protein, expressed by E. coli , with N-His labeled tag.

Background

CYB5R1, a member of the NADH-cytochrome b5 reductase family, plays a crucial role in diverse biological processes such as fatty acid desaturation and elongation, cholesterol biosynthesis, drug metabolism, and methemoglobin reduction in erythrocytes. As an essential component of these metabolic pathways, CYB5R1 utilizes NADH as a cofactor to facilitate the reduction of cytochrome b5, contributing to the enzymatic processes involved in lipid metabolism, sterol synthesis, and drug biotransformation. In erythrocytes, CYB5R1's involvement in methemoglobin reduction underscores its significance in maintaining hemoglobin functionality and preventing oxidative stress. The multifunctional nature of CYB5R1 positions it as a key player in cellular processes crucial for lipid homeostasis, hemoglobin function, and drug metabolism.

Biological Activity

Measured by its ability to combine with the NADPH produces the H2O2. The specific activity is 7661.210 pmoL/min/μg, as measured under the described conditions.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q9UHQ9 (L29-Y305)

Gene ID
Molecular Construction
N-term
His
CYB5R1 (L29-Y305)
Accession # Q9UHQ9
C-term
Protein Length

Partial

Synonyms
NADH-cytochrome b5 reductase 1; b5R.1; Humb5R2; NQO3A2
AA Sequence

LVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY

Molecular Weight

Approximately 32 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CYB5R1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CYB5R1 Protein, Human (His)
Cat. No.:
HY-P76856
Quantity:
MCE Japan Authorized Agent: