1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Chemokine & Receptors G-Protein-Coupled Receptors (GPCRs)
  4. CXC Chemokine Receptor Chemokine Receptor
  5. CXCR2
  6. CXCR2 Protein, Human (His-SUMO)

CXCR2, the receptor for interleukin-8 (IL-8), orchestrates neutrophil activation through a G-protein-mediated phosphatidylinositol-calcium second messenger system upon IL-8 binding. Exhibiting high-affinity binding to IL-8, CXCR2 also interacts with other ligands like CXCL3, GRO/MGSA, and NAP-2. The involvement of GNAI2 underscores the intricate signaling mechanisms regulating neutrophil function through CXCR2. CXCR2 Protein, Human (His-SUMO) is the recombinant human-derived CXCR2 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CXCR2, the receptor for interleukin-8 (IL-8), orchestrates neutrophil activation through a G-protein-mediated phosphatidylinositol-calcium second messenger system upon IL-8 binding. Exhibiting high-affinity binding to IL-8, CXCR2 also interacts with other ligands like CXCL3, GRO/MGSA, and NAP-2. The involvement of GNAI2 underscores the intricate signaling mechanisms regulating neutrophil function through CXCR2. CXCR2 Protein, Human (His-SUMO) is the recombinant human-derived CXCR2 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

CXCR2, the receptor for interleukin-8 (IL-8), a potent neutrophil chemotactic factor, orchestrates the activation of neutrophils upon IL-8 binding. This response is mediated through a G-protein, initiating a phosphatidylinositol-calcium second messenger system. CXCR2 exhibits high-affinity binding not only to IL-8 but also to other ligands such as CXCL3, GRO/MGSA, and NAP-2. The interaction with IL-8 and GNAI2 further highlights the intricate signaling mechanisms involved in the regulation of neutrophil function by CXCR2.

Species

Human

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

P25025 (M1-E40)

Gene ID
Molecular Construction
N-term
6*His-SUMO
CXCR2 (M1-E40)
Accession # P25025
C-term
Protein Length

Partial

Synonyms
C-X-C motif chemokine receptor 2; IL8RB, interleukin 8 receptor, beta; C-X-C chemokine receptor type 2; CD182; CMKAR2;
AA Sequence

MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCE

Molecular Weight

23-25 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of Tris-based buffer, 50% glycerol, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CXCR2 Protein, Human (His-SUMO)
Cat. No.:
HY-P700536
Quantity:
MCE Japan Authorized Agent: