CXCL17 Protein, Human

The CXCL17 protein is a chemokine that attracts monocytes, macrophages, and dendritic cells and plays a role in angiogenesis and potential tumor development. CXCL17 Protein, Human is the recombinant human-derived CXCL17 protein, expressed by E. coli , with tag free.

CXCL17 protein functions as a chemokine with chemoattractant properties for monocytes, macrophages, and dendritic cells, as demonstrated in various studies. Its involvement extends to angiogenesis and potentially tumor development, emphasizing its role in complex physiological processes. In the stomach, CXCL17 acts as an anti-inflammatory agent, contributing to local immune regulation. Additionally, there is a suggestion that CXCL17 may participate in the innate defense against infections, broadening its significance in immune responses. Through its interaction with the C-X-C chemokine receptor GPR35, CXCL17 induces a rapid and transient increase in intracellular calcium ions, adding a layer of specificity to its signaling mechanisms. Notably, CXCL17 exhibits a considerably higher chemoattractant potency on monocytes and macrophages compared to 6-Cys CXCL17, underscoring its distinct functional characteristics.

Fully biologically active when compared to standard. The ED50 as determined by its ability to induce VEGF expression using murine endothelial cells is less than 5.0 μg/mL, corresponding to a specific activity of >200 IU/mg.

Human

E. coli

Tag Free

Q6UXB2 (S22-L119)

284340  [NCBI]

Full Length of Mature Protein

SSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL

Approximately 12 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm concentrated solution in PBS with 3 % Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.