1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. GRO-alpha
  6. GRO-alpha/CXCL1 Protein, Human (His)

GRO-alpha/CXCL1 protein attracts neutrophils and potentially contributes to inflammation through autocrine effects on endothelial cells. Processed forms of GRO-alpha, including GRO-alpha(4-73), GRO-alpha(5-73), and GRO-alpha(6-73), exhibit 30-fold greater chemotactic activity than the full-length protein. GRO-alpha/CXCL1 Protein, Human (His) is the recombinant human-derived GRO-alpha/CXCL1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GRO-alpha/CXCL1 protein attracts neutrophils and potentially contributes to inflammation through autocrine effects on endothelial cells. Processed forms of GRO-alpha, including GRO-alpha(4-73), GRO-alpha(5-73), and GRO-alpha(6-73), exhibit 30-fold greater chemotactic activity than the full-length protein. GRO-alpha/CXCL1 Protein, Human (His) is the recombinant human-derived GRO-alpha/CXCL1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

GRO-alpha/CXCL1 protein exhibits chemotactic activity for neutrophils and may play a role in inflammation, exerting its effects on endothelial cells in an autocrine fashion. In vitro studies indicate that processed forms of GRO-alpha, namely GRO-alpha(4-73), GRO-alpha(5-73), and GRO-alpha(6-73), display a significantly enhanced chemotactic activity, being 30-fold higher compared to the full-length protein.

Biological Activity

Measured in a cell proliferation assay using HUVEC. The ED50 for this effect is 0.8611 ng/mL, corresponding to a specific activity is 1.16×106 units/mg.

  • Measured in a cell proliferation assay using HUVEC. The ED50 for this effect is 0.8611 ng/mL, corresponding to a specific activity is 1.16×106 units/mg.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

P09341 (A35-N107)

Gene ID
Molecular Construction
N-term
6*His
CXCL1 (A35-N107)
Accession # P09341
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Growth-Regulated Alpha Protein; C-X-C Motif Chemokine 1; GRO-Alpha(1-73); Melanoma Growth Stimulatory Activity; MGSA; Neutrophil-Activating Protein 3; NAP-3; CXCL1; GRO; GRO1; GROA; MGSA; SCYB1
AA Sequence

ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Molecular Weight

11.9 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose, 8% mannitol and 0.02% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GRO-alpha/CXCL1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GRO-alpha/CXCL1 Protein, Human (His)
Cat. No.:
HY-P700558
Quantity:
MCE Japan Authorized Agent: