CutA Protein, Human (His)

CUTA protein is a trimeric membrane anchor protein of AChE and a homolog of the bacterial divalent cation chelator CutA1 protein. CUTA protein also interacts with BACE1 and inhibits APP beta processing and Aβ production. CutA Protein, Human (His) is the recombinant human-derived CutA protein, expressed by E. coli , with C-6*His labeled tag.

CUTA protein is a membrane anchor protein of mammalian brain acetylcholinesterase (AChE) and is a trimeric protein that may form part of a membrane protein complex attached to acetylcholinesterase (AChE). Human CUTA is homologous to the bacterial CutA1 protein and is a divalent cation-tolerant homolog. Expression of longer CutA variants reduces AChE levels, an effect that depends on possible misfolding of the AChE C-terminal peptide. CutA increases secretion of mutants with a KDEL motif at the C terminus; it also increases AChE homotetramer formation. Longer CutA variants may affect secreted protein processing and trafficking, whereas shorter CutA variants may have unique functions in the cytoplasm. For example, CUTA proteins interact with β-secretase β-site APP cleavage 1 (BACE1) and inhibit APP β processing and Aβ production. Copper treatment promoted the increase in Aβ secretion induced by CUTA downregulation but had no effect on the CUTA-β site APP lyase 1 interaction. Therefore, indicating the mutual regulation of copper and CUTA, both regulate Aβ production through different mechanisms.

Human

E. coli

C-6*His

O60888-3 (M1-P156)

51596  [NCBI]

Full Length of Isoform-3

MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP

Approximately 17.0 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 1 mM DTT, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.