1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. CTRB1 Protein, Rat (HEK293, His)

CTRB1 Protein, Rat (HEK293, His) is the recombinant rat-derived CTRB1 protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CTRB1 Protein, Rat (HEK293, His) is the recombinant rat-derived CTRB1 protein, expressed by HEK293, with C-His labeled tag.

Background

Chymotrypsinogen B (CTRB1) is a member of the serine protease family of enzymes and forms a principal precursor of the pancreatic proteolytic enzymes. CTRB1 is synthesized in the acinar cells of the pancreas and secreted into the small intestine where it undergoes proteolytic activation to generate the functional enzyme. CTRB1 enables serine-type endopeptidase activity, being involved in response to apoptotic signal, nutrient, cytokine and peptide hormone. CTRB1 induces apoptosis through Bid cleavage activity, as the truncated Bid can in turn cause rapid mitochondrial release of cytochrome c. CTRB1 is located in lysosome and is a biomarker of pancreatitis. CTRB1 gene encodes distinct isoforms, which may undergo similar processing to generate the mature protein[1][2][3][4][5].

Biological Activity

Measured by its ability to cleave a peptide substrate, Suc-AAPF-pNA. Read at OD 410 nm. The specific activity is 969.68 pmol/min/mg, as measured under the described conditions.

Species

Rat

Source

HEK293

Tag

C-His

Accession

P07338 (C19-N263)

Gene ID
Molecular Construction
N-term
CTRB1 (M1-N263)
Accession # P07338
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Chymotrypsinogen B; CTRB1; CTRB
AA Sequence

CGVPTIQPVLTGLSRIVNGEDAIPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVKTSDVVVAGEFDQGSDEENIQVLKIAQVFKNPKFNMFTVRNDITLLKLATPAQFSETVSAVCLPNVDDDFPPGTVCATTGWGKTKYNALKTPEKLQQAALPIVSEADCKKSWGSKITDVMTCAGASGVSSCMGDSGGPLVCQKDGVWTLAGIVSWGSGVCSTSTPAVYSRVTALMPWVQQILEAN

Molecular Weight

Approximately 27 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CTRB1 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CTRB1 Protein, Rat (HEK293, His)
Cat. No.:
HY-P76852
Quantity:
MCE Japan Authorized Agent: