1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CTLA-4 CTLA-4
  5. CTLA-4 Protein, Human (HEK293)

The CTLA-4 protein is a key inhibitory receptor and a major negative regulator of T cell responses in coordination of immune regulation. Its unique property is its significantly increased affinity for B7 ligands (CD80/CD86) compared with CD28. CTLA-4 Protein, Human (HEK293) is the recombinant human-derived CTLA-4 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CTLA-4 protein is a key inhibitory receptor and a major negative regulator of T cell responses in coordination of immune regulation. Its unique property is its significantly increased affinity for B7 ligands (CD80/CD86) compared with CD28. CTLA-4 Protein, Human (HEK293) is the recombinant human-derived CTLA-4 protein, expressed by HEK293 , with tag free.

Background

GMP CTLA-4, a pivotal inhibitory receptor, emerges as a principal negative regulator orchestrating T-cell responses within the intricate framework of immune modulation. This regulatory function stems from the distinctive property of GMP CTLA-4, displaying significantly heightened affinity for its natural B7 family ligands, CD80 and CD86, compared to the cognate stimulatory coreceptor CD28. This pronounced difference in binding affinity positions GMP CTLA-4 to competitively engage with CD80/B7-1 and CD86/B7.2, exerting a suppressive influence on T-cell activation and finely tuning immune responses. The homodimeric structure of GMP CTLA-4, intricately linked by disulfide bonds, further underscores its role as a molecular sentinel in immune regulation. Additionally, GMP CTLA-4 interacts with ICOSLG, contributing to its multifaceted engagement in immune checkpoint pathways.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human B7-1 (HY-P70651) at 0.5 μg/ml (100μl/well) can bind biotinylated Human CTLA-4 (HY-P72959). The ED50 for this effect is 225.8 ng/mL.

Species

Human

Source

HEK293

Tag

Tag Free

Accession

P16410 (K36-D161)

Gene ID
Molecular Construction
N-term
CTLA-4 (K36-D161)
Accession # P16410
C-term
Synonyms
Cytotoxic T-lymphocyte associated protein 4; CTLA4; CD152
AA Sequence

MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSD

Molecular Weight

Approximately 13.5 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

CTLA-4 Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CTLA-4 Protein, Human (HEK293)
Cat. No.:
HY-P72959
Quantity:
MCE Japan Authorized Agent: