1. Recombinant Proteins
  2. Others
  3. CT83 Protein, Human (His, B2M)

The CT83 protein shows specific expression in the testis, highlighting its selective presence in this reproductive organ. In addition, multiple cancer cell lines express CT83, suggesting a potential association with malignancy. CT83 Protein, Human (His, B2M) is the recombinant human-derived CT83 protein, expressed by E. coli , with N-His, B2M labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE CT83 Protein, Human (His, B2M)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CT83 protein shows specific expression in the testis, highlighting its selective presence in this reproductive organ. In addition, multiple cancer cell lines express CT83, suggesting a potential association with malignancy. CT83 Protein, Human (His, B2M) is the recombinant human-derived CT83 protein, expressed by E. coli , with N-His, B2M labeled tag.

Background

CT83 protein exhibits specific expression in the testis, emphasizing its selective presence within this reproductive organ. Additionally, it is expressed by various cancer cell lines, suggesting a potential association with malignancies. The dual expression pattern of CT83 in both normal testicular tissues and cancer cells underscores its relevance in contexts ranging from normal physiological functions to pathological conditions. This distinctive expression profile hints at a potential role for CT83 in reproductive processes and implicates its involvement in cancer-related mechanisms. The dual expression in testicular and cancerous contexts highlights the versatility of CT83 and underscores its significance in both normal and disease-associated cellular contexts.

Species

Human

Source

E. coli

Tag

N-His;B2M

Accession

Q5H943 (M1-T113)

Gene ID
Molecular Construction
N-term
6*His-B2M
CT83 (M1-T113)
Accession # Q5H943
C-term
Protein Length

Full Length

Synonyms
CT83; CXorf61; KKLC1; Kita-kyushu lung cancer antigen 1; KK-LC-1; Cancer/testis antigen 83
AA Sequence

MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

Molecular Weight

Approximately 26.8 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CT83 Protein, Human (His, B2M) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CT83 Protein, Human (His, B2M)
Cat. No.:
HY-P71562
Quantity:
MCE Japan Authorized Agent: