1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. G-CSF
  5. CSF3 Protein, Rhesus macaque

CSF3 Protein, a member of the IL-6 superfamily, is a vital granulocyte/macrophage colony-stimulating factor influencing hematopoiesis. It regulates the production, differentiation, and function of granulocytes and monocytes-macrophages, playing a key role in the intricate balance of hematopoietic processes. CSF3's significance within the IL-6 superfamily extends to orchestrating immune system components for optimal functionality. CSF3 Protein, Rhesus macaque is the recombinant Rhesus Macaque-derived CSF3 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CSF3 Protein, a member of the IL-6 superfamily, is a vital granulocyte/macrophage colony-stimulating factor influencing hematopoiesis. It regulates the production, differentiation, and function of granulocytes and monocytes-macrophages, playing a key role in the intricate balance of hematopoietic processes. CSF3's significance within the IL-6 superfamily extends to orchestrating immune system components for optimal functionality. CSF3 Protein, Rhesus macaque is the recombinant Rhesus Macaque-derived CSF3 protein, expressed by E. coli , with tag free.

Background

The CSF3 Protein, belonging to the IL-6 superfamily, is a granulocyte/macrophage colony-stimulating factor that plays a crucial role in hematopoiesis. This cytokine exerts control over the production, differentiation, and function of two interconnected white cell populations in the blood, namely granulocytes and monocytes-macrophages. Specifically, CSF3 induces the generation of granulocytes, contributing to the intricate regulation of hematopoietic processes. As a key member of the IL-6 superfamily, CSF3 holds significance in orchestrating the balance and functionality of essential components within the immune system.

Biological Activity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine NFS-60 cells is 1.5-50 pg/mL, corresponding to a specific activity of >2.0x107 IU/mg.

Species

Rhesus Macaque

Source

E. coli

Tag

Tag Free

Accession

F7H1Q6 (T31-S207)

Gene ID

/

Molecular Construction
N-term
CSF3 (T31-S207)
Accession # F7H1Q6
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Granulocyte colony-stimulating factor; CSF3
AA Sequence

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLRHSLGIPWAPLSSCPSQALQLTGCLSQLHSSLFLYQGLLQALEGISPELSPTLDTLQLDIADFATTIWQQMEDLGMAPALQPTQGAMPAFTSAFQRRAGGVLVASHLQRFLELAYRVLRHLAQS

Predicted Molecular Mass
19.2 kDa
Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CSF3 Protein, Rhesus macaque Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CSF3 Protein, Rhesus macaque
Cat. No.:
HY-P71877
Quantity:
MCE Japan Authorized Agent: