GM-CSF Protein, Bovine (P. pastoris, His-Myc)

The GM-CSF protein is a key cytokine that fundamentally stimulates the growth and differentiation of hematopoietic precursor cells, including granulocytes, macrophages, eosinophils, and erythrocytes. As a monomer, GM-CSF interacts with the GM-CSF receptor complex to form a dodecamer, which contains two α, two β, and two head-to-head hexamers of the ligand subunits. GM-CSF Protein, Bovine (P. pastoris, His-Myc) is the recombinant bovine-derived GM-CSF protein, expressed by P. pastoris , with C-Myc, C-6*His labeled tag.

The GM-CSF Protein, a pivotal cytokine, plays a fundamental role in stimulating the growth and differentiation of hematopoietic precursor cells from diverse lineages, encompassing granulocytes, macrophages, eosinophils, and erythrocytes. Existing as a monomer, GM-CSF exerts its biological effects through the GM-CSF receptor complex, which forms a dodecamer comprising two head-to-head hexamers of two alpha, two beta, and two ligand subunits. This intricate receptor complex underscores the multi-faceted nature of GM-CSF in orchestrating cellular responses critical for hematopoiesis and immune function.

Bovine

P. pastoris

C-Myc;C-6*His

P11052 (A18-K143)

281095  [NCBI]

Full Length of Mature Protein

APTRPPNTATRPWQHVDAIKEALSLLNHSSDTDAVMNDTEVVSEKFDSQEPTCLQTRLKLYKNGLQGSLTSLMGSLTMMATHYEKHCPPTPETSCGTQFISFKNFKEDLKEFLFIIPFDCWEPAQK

24 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0 .

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.