1. Recombinant Proteins
  2. CD Antigens
  3. NK Cell CD Proteins
  4. CRTAM/CD355
  5. CRTAM/CD355 Protein, Cynomolgus (HEK293, His)

CRTAM/CD355 Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P7807
Handling Instructions Technical Support

CRTAM/CD355 Protein is an immunoglobulin-superfamily transmembrane protein, and is a member of nectin-like protein superfamily. CRTAM is also expressed on activated human NK cells, CD8+ T cells and a subset of CD4+ T cells. CRTAM takes part in cellular adhesion, polarity, and proliferation. CRTAM also regulates lymphocyte function, and promotes TCD8+ cell adhesion and retention within the lymph node. Furthermore, CRTAM can interact with Necl-2, and promotes cytotoxicity of NK cells and IFN-γ secretion of CD8+ T cells in vitro, and NK cell-mediated rejection of tumors expressing Necl-2 in vivosup>[3]. CRTAM/CD355 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CRTAM/CD355 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CRTAM/CD355 Protein is an immunoglobulin-superfamily transmembrane protein, and is a member of nectin-like protein superfamily. CRTAM is also expressed on activated human NK cells, CD8+ T cells and a subset of CD4+ T cells. CRTAM takes part in cellular adhesion, polarity, and proliferation. CRTAM also regulates lymphocyte function, and promotes TCD8+ cell adhesion and retention within the lymph node. Furthermore, CRTAM can interact with Necl-2, and promotes cytotoxicity of NK cells and IFN-γ secretion of CD8+ T cells in vitro, and NK cell-mediated rejection of tumors expressing Necl-2 in vivo[1][2]sup>[3][4]. CRTAM/CD355 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CRTAM/CD355 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Class I-restricted T cell-associated molecule (CRTAM) is an immunoglobulin-superfamily transmembrane protein, and is a member of nectin-like protein superfamily. CRTAM is also known as CD355 or cytotoxic and regulatory T-cell molecule (expressed by activated CD8+ and NK T cells). In addition, CRTAM is expressed in several non-immune tissues, including liver, lung, testis, kidney, intestine, and brain. CRTAM is also expressed on activated human NK cells, CD8+ T cells and a subset of CD4+ T cells. Noticeably, activated T cells and NK cells only transiently express CRTAM[1][3].
CRTAM takes part in kinds of signaling pathways, including cellular adhesion, polarity, and proliferation. CRTAM regulates lymphocyte function, and also promotes TCD8+ cell adhesion and retention within the lymph node. Besides, it induces a late phase of cell polarity during activation and regulates effector function in a small subset of TCD4 cells[1][2]. Furthermore, CRTAM can interact with Necl-2 (a ligand for CRTAM), and promotes cytotoxicity of NK cells and IFN-γ secretion of CD8+ T cells in vitro, as well as NK cell-mediated rejection of tumors expressing Necl-2 in vivo. CRTAM shows some sequence homology to nectins and Necls[3][4].

Species

Cynomolgus

Source

HEK293

Tag

C-6*His

Accession

XP_005580021.1 (S18-G287)

Gene ID
Molecular Construction
N-term
CRTAM (S18-G287)
Accession # XP_005580021.1
6*His
C-term
Protein Length

Partial

Synonyms
rCynCRTAM, His; Cytotoxic and Regulatory T-Cell Molecule; Class-I MHC-Restricted T-Cell-Associated Molecule; CD355; CRTAM
AA Sequence

SLTNHTETITVEEGQTLTLKCVTSLRKSSSLQWLTPSGFTIFLNEYPAFKNSRYQLLHHSANQLSISVSNITLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSAMRSKPPPQITWLLGNGVEVSGGTHHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSVSSQDPQQPTSTVSVMEDSSTLEIDKEEKEQTTQDPDLTTKANPQYLGLARKKSG

Predicted Molecular Mass
30.8 kDa
Molecular Weight

Approximately 50-60 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CRTAM/CD355 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CRTAM/CD355 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P7807
Quantity:
MCE Japan Authorized Agent: