1. Recombinant Proteins
  2. CD Antigens
  3. NK Cell CD Proteins
  4. CRTAM/CD355
  5. CRTAM/CD355 Protein, Human (HEK293, His)

The CRTAM/CD355 protein is a key mediator of heterophilic intercellular adhesion and complexly regulates the activation, differentiation, and tissue retention of T cell subsets. Its interaction with CADM1 promotes NK cell cytotoxicity and CD8+ T cell secretion of IFNG, thus contributing to NK cell-mediated tumor rejection. CRTAM/CD355 Protein, Human (HEK293, His) is the recombinant human-derived CRTAM/CD355 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CRTAM/CD355 protein is a key mediator of heterophilic intercellular adhesion and complexly regulates the activation, differentiation, and tissue retention of T cell subsets. Its interaction with CADM1 promotes NK cell cytotoxicity and CD8+ T cell secretion of IFNG, thus contributing to NK cell-mediated tumor rejection. CRTAM/CD355 Protein, Human (HEK293, His) is the recombinant human-derived CRTAM/CD355 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CRTAM/CD355 Protein serves as a crucial mediator of heterophilic cell-cell adhesion, intricately regulating the activation, differentiation, and tissue retention of various T-cell subsets. Its interaction with CADM1 plays a pivotal role in promoting natural killer (NK) cell cytotoxicity, as well as IFNG/interferon-gamma secretion by CD8+ T-cells both in vitro and in vivo, contributing to NK cell-mediated rejection of CADM1-expressing tumors. CRTAM also modulates CD8+ T-cell proliferation in response to T-cell receptor (TCR) activation and, through interaction with SCRIB, facilitates the late phase of cellular polarization in a subset of CD4+ T-cells, regulating TCR-mediated proliferation and cytokine production. Moreover, CRTAM's interaction with CADM1 on CD8+ dendritic cells regulates the retention of activated CD8+ T-cells within draining lymph nodes. Essential for the intestinal retention of intraepithelial T-cell subsets, CRTAM further promotes adhesion to gut-associated CD103+ dendritic cells, facilitating the expression of gut-homing and adhesion molecules on T-cells. As a monomer that may form homodimers, CRTAM's intricate interactions, particularly with CADM1 and SCRIB, highlight its central role in orchestrating diverse cellular functions critical for immune responses and tissue homeostasis. Further exploration of these interactions will shed light on the precise mechanisms underlying CRTAM's regulatory functions.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O95727-1 (S18-S286)

Gene ID
Molecular Construction
N-term
CRTAM (S18-S286)
Accession # O95727-1
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
rHuCytotoxic and regulatory T-cell molecule/CRTAM, His; Cytotoxic and Regulatory T-Cell Molecule; Class-I MHC-Restricted T-Cell-Associated Molecule; CD355; CRTAM
AA Sequence

SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKS

Molecular Weight

58-64 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CRTAM/CD355 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CRTAM/CD355 Protein, Human (HEK293, His)
Cat. No.:
HY-P7855
Quantity:
MCE Japan Authorized Agent: