Creatine kinase M-type/CKM Protein, Human (His)

Creatine kinase M-type/CKM Protein, Human (His) is the recombinant human-derived Creatine kinase M-type/CKM protein, expressed by E. coli, with N-His labeled tag.

KCRM is a cytoplasmic creatine kinase isoenzyme that reversibly catalyzes phosphate transfer between ATP and various phosphogens (e.g., creatine phosphate). KCRM is involved in energy transduction and energy homeostasis in tissues with large and fluctuating energy demands, such as skeletal muscle, heart, brain, and sperm, and is an important serum marker of myocardial infarction. KCRM acts as a homodimer in striated muscle and other tissues and as a heterodimer in the heart with similar brain isozymes. Skeletal muscle, as an important secretory organ, differentially secretes cleaved KCRM peptide in type 2 diabetes mellitus (T2DM) skeletal muscle tissue. Naturally occurring mutations in KCRM may render individuals with active serum creatine kinase unresponsive to Tenofovir (HY-13910) pre-exposure prophylaxis (PrEP) HIV.

Measured by its ability to phosphorylate creatine. The specific activity is 3604.044 pmol/min/μg, as measured under the described conditions.

Human

E. coli

N-His

AAH07462.1 (M1-K381)

1158  [NCBI]

Full Length

MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

Approximately 45 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 100 mM HEPES, pH 7.0 or 50 mM HEPES, 300 mM NaCl, pH 7.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.