1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. Creatine kinase M-type/CKM Protein, Mouse (His)

Creatine kinase M-type/CKM Protein, Mouse (His)

Cat. No.: HY-P700577
Handling Instructions Technical Support

CKM is a creatine kinase M-type protein that centrally catalyzes reversible phosphate transfer between ATP and various phosphogens, especially creatine phosphate. As a creatine kinase isoenzyme, CKM plays a crucial role in energy transduction, particularly in tissues with large and fluctuating energy demands, such as skeletal muscle, heart, brain, and sperm. Creatine kinase M-type/CKM Protein, Mouse (His) is the recombinant mouse-derived Creatine kinase M-type/CKM protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CKM is a creatine kinase M-type protein that centrally catalyzes reversible phosphate transfer between ATP and various phosphogens, especially creatine phosphate. As a creatine kinase isoenzyme, CKM plays a crucial role in energy transduction, particularly in tissues with large and fluctuating energy demands, such as skeletal muscle, heart, brain, and sperm. Creatine kinase M-type/CKM Protein, Mouse (His) is the recombinant mouse-derived Creatine kinase M-type/CKM protein, expressed by E. coli , with N-6*His labeled tag.

Background

The Creatine Kinase M-type (CKM) protein is pivotal in reversibly catalyzing the transfer of phosphate between ATP and various phosphogens, including creatine phosphate. Operating as a creatine kinase isoenzyme, CKM assumes a central role in energy transduction processes, particularly in tissues characterized by substantial and fluctuating energy demands. These tissues encompass skeletal muscle, heart, brain, and spermatozoa, where CKM facilitates the efficient utilization and storage of energy. In doing so, creatine kinase isoenzymes, exemplified by CKM, contribute significantly to maintaining energy homeostasis and meeting dynamic metabolic requirements within these vital tissues.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P07310 (M1-K381)

Gene ID
Molecular Construction
N-term
6*His
CKM (M1-K381)
Accession # P07310
C-term
Synonyms
rHuCreatine kinase M-type/CKMM, His; Creatine kinase M-type; Creatine kinase M chain; M-CK; CKM; CKMM
AA Sequence

MPFGNTHNKFKLNYKPQEEYPDLSKHNNHMAKVLTPDLYNKLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYTVFKDLFDPIIQDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLANLSKHPKFEEILTRLRLQKRGTGGVDTAAVGAVFDISNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

Molecular Weight

49.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Creatine kinase M-type/CKM Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Creatine kinase M-type/CKM Protein, Mouse (His)
Cat. No.:
HY-P700577
Quantity:
MCE Japan Authorized Agent: