1. Recombinant Proteins
  2. Others
  3. CRABP2 Protein, Mouse (His)

CRABP2 is an important mediator that promotes intracellular retinoic acid transport and regulates its contact with nuclear retinoic acid receptors. This key role is essential for the cellular processes controlled by retinoic acid. CRABP2 Protein, Mouse (His) is the recombinant mouse-derived CRABP2 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CRABP2 is an important mediator that promotes intracellular retinoic acid transport and regulates its contact with nuclear retinoic acid receptors. This key role is essential for the cellular processes controlled by retinoic acid. CRABP2 Protein, Mouse (His) is the recombinant mouse-derived CRABP2 protein, expressed by E. coli , with N-His labeled tag.

Background

CRABP2, a critical cellular mediator, plays a pivotal role in the intracellular transport of retinoic acid, facilitating its transit to the nucleus and regulating its access to nuclear retinoic acid receptors. This transport mechanism is central to the intricate cellular processes governed by retinoic acid. Additionally, CRABP2 engages in essential interactions within the cellular milieu, forming complexes with importin alpha, which contribute to its regulatory functions (By similarity). Furthermore, CRABP2 establishes crucial molecular associations with retinoid X receptor (RXR) and retinoic acid receptor alpha (RARA), highlighting its involvement in the intricate network of nuclear receptor signaling pathways. These interactions collectively underscore CRABP2's pivotal role in orchestrating retinoic acid dynamics and its downstream regulatory effects.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P22935 (P2-E138)

Gene ID
Molecular Construction
N-term
His
CRABP2 (P2-E138)
Accession # P22935
C-term
Synonyms
Cellular retinoic acid-binding protein 2; CRABP-II; CRABP2
AA Sequence

PNFSGNWKIIRSENFEEMLKALGVNMMMRKIAVAAASKPAVEIKQENDTFYIKTSTTVRTTEINFKIGEEFEEQTVDGRPCKSLVKWESGNKMVCEQRLLKGEGPKTSWSRELTNDGELILTMTADDVVCTRVYVRE

Molecular Weight

Approximately 16 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CRABP2 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CRABP2 Protein, Mouse (His)
Cat. No.:
HY-P75689
Quantity:
MCE Japan Authorized Agent: