1. Recombinant Proteins
  2. Others
  3. CRABP2 Protein, Human (His)

CRABP2 (cellular retinoic acid binding protein 2) plays a crucial role in cellular processes by transporting retinoic acid into the nucleus and mediating its contact with nuclear retinoic acid receptors. CRABP2 interacts with RXR (retinoic acid X receptor) and RARA (retinoic acid receptor Alpha) to regulate the retinoic acid signaling pathway. CRABP2 Protein, Human (His) is the recombinant human-derived CRABP2 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CRABP2 (cellular retinoic acid binding protein 2) plays a crucial role in cellular processes by transporting retinoic acid into the nucleus and mediating its contact with nuclear retinoic acid receptors. CRABP2 interacts with RXR (retinoic acid X receptor) and RARA (retinoic acid receptor Alpha) to regulate the retinoic acid signaling pathway. CRABP2 Protein, Human (His) is the recombinant human-derived CRABP2 protein, expressed by E. coli , with N-His labeled tag.

Background

CRABP2 (Cellular Retinoic Acid-Binding Protein 2) plays a pivotal role in cellular processes by facilitating the transportation of retinoic acid to the nucleus, where it regulates the access of retinoic acid to nuclear retinoic acid receptors. Through interactions with RXR (Retinoid X Receptor) and RARA (Retinoic Acid Receptor Alpha), CRABP2 contributes to the modulation of retinoic acid signaling pathways. Additionally, CRABP2 engages with importin alpha, indicating its involvement in the intricate mechanisms of nuclear transport, further highlighting its significance in mediating retinoic acid-related cellular responses.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P29373 (P2-E138)

Gene ID
Molecular Construction
N-term
His
CRABP2 (P2-E138)
Accession # P29373
C-term
Synonyms
Cellular retinoic acid-binding protein 2; CRABP-II; CRABP2
AA Sequence

PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE

Molecular Weight

Approximately 16 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CRABP2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CRABP2 Protein, Human (His)
Cat. No.:
HY-P75688
Quantity:
MCE Japan Authorized Agent: