1. Recombinant Proteins
  2. Viral Proteins
  3. HCoV-OC43 Spike/S Protein (sf9, His, myc)

HCoV-OC43 Spike/S Protein, particularly the S1 subunit, initiates infection by attaching the virion to the cell membrane. It interacts with sialic acid-containing cell receptors, facilitating virus binding and marking the initial step in the infection process, establishing a connection with the host receptor for infection commencement. HCoV-OC43 Spike/S Protein (sf9, His, myc) is the recombinant Virus-derived HCoV-OC43 Spike/S protein, expressed by sf9 insect cells , with C-Myc, N-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HCoV-OC43 Spike/S Protein, particularly the S1 subunit, initiates infection by attaching the virion to the cell membrane. It interacts with sialic acid-containing cell receptors, facilitating virus binding and marking the initial step in the infection process, establishing a connection with the host receptor for infection commencement. HCoV-OC43 Spike/S Protein (sf9, His, myc) is the recombinant Virus-derived HCoV-OC43 Spike/S protein, expressed by sf9 insect cells , with C-Myc, N-10*His labeled tag.

Background

The HCoV-OC43 Spike (S) Protein, specifically the S1 subunit, plays a crucial role in the initiation of infection by attaching the virion to the cell membrane. S1 accomplishes this by interacting with sialic acid-containing cell receptors, facilitating the binding of the virus to the host cell membrane. This pivotal interaction marks the initial step in the infection process, allowing the virus to establish a connection with the host receptor and commence the infection.

Species

Virus

Source

Sf9 insect cells

Tag

C-Myc;N-10*His

Accession

P36334 (V15-K344)

Gene ID

/

Molecular Construction
N-term
10*His
HCoV-OC43 S (V15-K344)
Accession # P36334
C-term
Protein Length

Partial

Synonyms
E2; Peplomer protein ; Human coronavirus OC43 Spike glycoprotein
AA Sequence

VIGDLKCTSDNINDKDTGPPPISTDTVDVTNGLGTYYVLDRVYLNTTLFLNGYYPTSGSTYRNMALKGSVLLSRLWFKPPFLSDFINGIFAKVKNTKVIKDRVMYSEFPAITIGSTFVNTSYSVVVQPRTINSTQDGDNKLQGLLEVSVCQYNMCEYPQTICHPNLGNHRKELWHLDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGMALSHYYVMPLTCNSKLTLEYWVTPLTSRQYLLAFNQDGIIFNAEDCMSDFMSEIKCKTQSIAPPTGVYELNGYTVQPIADVYRRKPNLPNCNIEAWLNDK

Molecular Weight

Approximately 41.0 kDa

Glycosylation
Yes
Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 3% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1.0 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HCoV-OC43 Spike/S Protein (sf9, His, myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HCoV-OC43 Spike/S Protein (sf9, His, myc)
Cat. No.:
HY-P72269
Quantity:
MCE Japan Authorized Agent: