1. Recombinant Proteins
  2. Others
  3. Cornulin Protein, Human (His)

Cornulin protein is critical in cell dynamics, promoting proliferation and promoting G1/S cell cycle progression, inducing the key regulator CCND1. It actively participates in the NFKB1 and PI3K/AKT pathways and responds to pro-inflammatory cytokines. Cornulin Protein, Human (His) is the recombinant human-derived Cornulin protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cornulin protein is critical in cell dynamics, promoting proliferation and promoting G1/S cell cycle progression, inducing the key regulator CCND1. It actively participates in the NFKB1 and PI3K/AKT pathways and responds to pro-inflammatory cytokines. Cornulin Protein, Human (His) is the recombinant human-derived Cornulin protein, expressed by E. coli , with N-6*His labeled tag.

Background

Cornulin Protein takes on a pivotal role in cellular dynamics by promoting cell proliferation and facilitating G1/S cell cycle progression. Its influence extends to the induction of CCND1, a crucial cell cycle regulator. Furthermore, Cornulin orchestrates the regulation of proliferation in response to pro-inflammatory cytokines, actively engaging the NFKB1 and PI3K/AKT signaling pathways. Operating as a homodimer, Cornulin emerges as a multifaceted player in cellular processes, contributing to the intricate balance of cell cycle control and response to inflammatory cues. The orchestrated interplay of Cornulin in these pathways underscores its significance in regulating cellular proliferation and highlights its potential implications in physiological and pathological contexts. Further exploration is warranted to comprehensively understand the specific molecular mechanisms underlying Cornulin's intricate involvement in cell cycle regulation and its responsiveness to pro-inflammatory stimuli.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9UBG3 (M1-S140)

Gene ID
Molecular Construction
N-term
6*His
Cornulin (M1-S140)
Accession # Q9UBG3
C-term
Protein Length

Partial

Synonyms
rHuCornulin, His; Cornulin; 53 kDa Putative Calcium-Binding Protein; 53 kDa Squamous Epithelial-Induced Stress Protein; 58 kDa Heat Shock Protein; Squamous Epithelial Heat Shock Protein 53; Tumor-Related Protein; CRNN; C1orf10; DRC1; PDRC1; SEP53
AA Sequence

MPQLLQNINGIIEAFRRYARTEGNCTALTRGELKRLLEQEFADVIVKPHDPATVDEVLRLLDEDHTGTVEFKEFLVLVFKVAQACFKTLSESAEGACGSQESGSLHSGASQELGEGQRSGTEVGRAGKGQHYEGSSHRQS

Molecular Weight

Approximately 17.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Cornulin Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cornulin Protein, Human (His)
Cat. No.:
HY-P70116
Quantity:
MCE Japan Authorized Agent: