1. Recombinant Proteins
  2. Complement System
  3. Complement Regulatory Proteins
  4. Factor D
  5. Complement Factor D/Adipsin Protein, Mouse (HEK293, His)

Complement Factor D/Adipsin Protein, Mouse (HEK293, His)

Cat. No.: HY-P7876
Handling Instructions Technical Support

Complement Factor D/Adipsin Protein cleaves factor B in complex with factor C3b, activating the C3bbb complex to form the C3 convertase in the alternate pathway, analogous to C1s in the classical pathway. Complement Factor D/Adipsin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Complement Factor D/Adipsin protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Complement Factor D/Adipsin Protein cleaves factor B in complex with factor C3b, activating the C3bbb complex to form the C3 convertase in the alternate pathway, analogous to C1s in the classical pathway. Complement Factor D/Adipsin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Complement Factor D/Adipsin protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Complement Factor D/Adipsin Protein functions by cleaving factor B, specifically when it is complexed with factor C3b. This cleavage activates the C3bbb complex, transforming it into the C3 convertase of the alternate pathway. The protein's role is homologous to that of C1s in the classical pathway.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P03953-1 (I26-S259)

Gene ID

11537  [NCBI]

Molecular Construction
N-term
CFD (I26-S259)
Accession # P03953-1
6*His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
rMuComplement Factor D/Adipsin, His; Complement factor D; 28 kDa adipocyte protein; Adipsin; C3 convertase activator; Properdin factor D; Cfd; Adn; Df
AA Sequence

ILGGQEAAAHARPYMASVQVNGTHVCGGTLLDEQWVLSAAHCMDGVTDDDSVQVLLGAHSLSAPEPYKRWYDVQSVVPHPGSRPDSLEDDLILFKLSQNASLGPHVRPLPLQYEDKEVEPGTLCDVAGWGVVTHAGRRPDVLHQLRVSIMNRTTCNLRTYHDGVVTINMMCAESNRRDTCRGDSGSPLVCGDAVEGVVTWGSRVCGNGKKPGVYTRVSSYRMWIENITNGNMTS

Molecular Weight

40-49 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Complement Factor D/Adipsin Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Complement Factor D/Adipsin Protein, Mouse (HEK293, His)
Cat. No.:
HY-P7876
Quantity:
MCE Japan Authorized Agent: