1. Recombinant Proteins
  2. Complement System
  3. Complement Component 8
  4. Complement Component 8 gamma Chain
  5. Complement C8G Protein, Human (His)

C8G/C8 γ is the γ subunit of the C8 protein of the complement system and is mainly localized in brain astrocytes. C8G/C8 γ is a neuroinflammation inhibitor that interacts with S1PR2 and jointly antagonizes the pro-inflammatory activity of S1P in microglia. Complement C8G Protein, Human (His) is the recombinant human-derived Complement C8G protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

C8G/C8 γ is the γ subunit of the C8 protein of the complement system and is mainly localized in brain astrocytes. C8G/C8 γ is a neuroinflammation inhibitor that interacts with S1PR2 and jointly antagonizes the pro-inflammatory activity of S1P in microglia. Complement C8G Protein, Human (His) is the recombinant human-derived Complement C8G protein, expressed by E. coli , with N-6*His labeled tag.

Background

C8G/C8 γ is the γ subunit of the C8 protein of the complement system and is mainly localized in brain astrocytes. The C8 protein is one of five components (C5b, C6, C7, C8, C9) that interact to form the complement cytolytic membrane attack complex (MAC). Can bind to the C5B-7 complex to form the C5B-8 complex. C5-B8 binds to C9 and acts as a catalyst in C9 polymerization. C8γ is unique in that it belongs to the lipocalin family of small secreted proteins and has the ability to bind small hydrophobic ligands. Cysteine residues of C8γ can bind to disulfide bonds of C8α and have inhibitory effects in neuroinflammation. In Alzheimer's disease patients with intense neuroinflammation, C8G levels are higher in brain tissue, cerebrospinal fluid, and plasma. Use of recombinant C8G protein inhibits glial hyperactivation, neuroinflammation, and cognitive decline in animal models of acute and chronic Alzheimer's disease. S1PR2 is a novel interacting protein of C8G, and together they antagonize the proinflammatory effects of S1P in microglia.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

AAI13627.1 (Q21-R202)

Gene ID

733  [NCBI]

Molecular Construction
N-term
6*His
Complement C8G (Q21-R202)
Accession # AAI13627.1
C-term
Protein Length

Partial

Synonyms
rHuComplement component C8 gamma chain/C8G, His; Complement component C8 gamma chain; C8G
AA Sequence

QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR

Molecular Weight

Approximately 22.0-23.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Complement C8G Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Complement C8G Protein, Human (His)
Cat. No.:
HY-P7824
Quantity:
MCE Japan Authorized Agent: