1. Recombinant Proteins
  2. Complement System
  3. Complement Component 5
  4. Complement Component 5a
  5. Complement C5a anaphylatoxin Protein, Pig (P.pastoris, His)

Complement C5a anaphylatoxin Protein, Pig (P.pastoris, His)

Cat. No.: HY-P71719
Handling Instructions Technical Support

Complement C5/C5a Protein, a component of the complement system, is involved in the immune response and inflammation. It is cleaved to generate C5a, a potent pro-inflammatory mediator. Complement C5/C5a Protein's role in immune regulation and its potential as a therapeutic target make it a promising candidate for the treatment of inflammatory disorders and autoimmune diseases. Complement C5a anaphylatoxin Protein, Pig (P.pastoris, His) is the recombinant pig-derived Complement C5a anaphylatoxin protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Complement C5/C5a Protein, a component of the complement system, is involved in the immune response and inflammation. It is cleaved to generate C5a, a potent pro-inflammatory mediator. Complement C5/C5a Protein's role in immune regulation and its potential as a therapeutic target make it a promising candidate for the treatment of inflammatory disorders and autoimmune diseases. Complement C5a anaphylatoxin Protein, Pig (P.pastoris, His) is the recombinant pig-derived Complement C5a anaphylatoxin protein, expressed by P. pastoris , with N-His labeled tag.

Background

Derived from the proteolytic degradation of complement C5, Complement C5a protein serves as a pivotal mediator in local inflammatory processes. Upon binding to its receptor, C5AR1, C5a elicits diverse responses, including the release of intracellular calcium, smooth muscle contraction, heightened vascular permeability, and histamine release from mast cells and basophilic leukocytes. Functioning as a potent chemokine, C5a actively stimulates the migration of polymorphonuclear leukocytes, directing their movement towards sites of inflammation. The interaction with C5AR1 is central to orchestrating these immunomodulatory effects.

Species

Pig

Source

P. pastoris

Tag

N-His

Accession

P01032 (M1-R74)

Gene ID
Molecular Construction
N-term
His
C5a (M1-R74)
Accession # P01032
C-term
Protein Length

Full Length

Synonyms
C5; Complement C5a anaphylatoxin
AA Sequence

MLQKKIEEEAAKYKYAMLKKCCYDGAYRNDDETCEERAARIKIGPKCVKAFKDCCYIANQVRAEQSHKNIQLGR

Molecular Weight

Approximately 10.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Complement C5a anaphylatoxin Protein, Pig (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Complement C5a anaphylatoxin Protein, Pig (P.pastoris, His)
Cat. No.:
HY-P71719
Quantity:
MCE Japan Authorized Agent: