1. Recombinant Proteins
  2. Others
  3. Collectin-11/CL-K1 Protein, Human (HEK293, His)

Collectin-11/CL-K1 Protein, Human (HEK293, His)

Cat. No.: HY-P70100
Handling Instructions Technical Support

Collectin-11/CL-K1 is an important lectin in innate immunity, apoptosis, and embryogenesis that recognizes sugars presenting high mannose oligosaccharides with at least one terminal α-1,2-linked mannose epitope protein. It also recognizes fucosylated glycans and lipopolysaccharides. Collectin-11/CL-K1 Protein, Human (HEK293, His) is the recombinant human-derived Collectin-11/CL-K1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Collectin-11/CL-K1 is an important lectin in innate immunity, apoptosis, and embryogenesis that recognizes sugars presenting high mannose oligosaccharides with at least one terminal α-1,2-linked mannose epitope protein. It also recognizes fucosylated glycans and lipopolysaccharides. Collectin-11/CL-K1 Protein, Human (HEK293, His) is the recombinant human-derived Collectin-11/CL-K1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The Collectin-11/CL-K1 protein serves as a lectin crucial in innate immunity, apoptosis, and embryogenesis. This calcium-dependent lectin recognizes self and non-self glycoproteins presenting high mannose oligosaccharides with at least one terminal alpha-1,2-linked mannose epitope, primarily focusing on the terminal disaccharide of the glycan. Additionally, it identifies a subset of fucosylated glycans and lipopolysaccharides. In innate immunity, Collectin-11/CL-K1 binds non-self sugars on microorganisms, activating the complement through the recruitment of MAPS1. In apoptosis, the protein binds DNA on the surface of apoptotic cells in a calcium-independent manner, triggering complement activation in response to this binding. Furthermore, Collectin-11/CL-K1 contributes to development, potentially serving as a guidance cue during the migration of neural crest cells and other cell types in embryogenesis. The protein forms homotrimers through disulfide linkages and interacts with MASP1, likely initiating the lectin pathway of complement activation.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9BWP8 (Q26-M271)

Gene ID
Molecular Construction
N-term
CL-K1 (Q26-M271)
Accession # Q9BWP8
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuCollectin-11/CL-K1, His; Collectin-11; Collectin Kidney Protein 1; CL-K1; COLEC11
AA Sequence

QPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM

Molecular Weight

30-35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Collectin-11/CL-K1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Collectin-11/CL-K1 Protein, Human (HEK293, His)
Cat. No.:
HY-P70100
Quantity:
MCE Japan Authorized Agent: