CNR2 Protein-VLP, Human (HEK293)

CNR2 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

CNR2 Protein-VLP, a heterotrimeric G protein-coupled receptor for the endocannabinoid 2-arachidonoylglycerol, plays a pivotal role in mediating the inhibition of adenylate cyclase. Its versatile functionality extends to potential involvement in inflammatory responses, nociceptive transmission, and bone homeostasis. The receptor's ability to modulate cellular signaling pathways highlights its significance in various physiological processes, making CNR2 Protein-VLP a key player in the intricate regulation of inflammatory and sensory mechanisms, as well as contributing to the maintenance of bone equilibrium.

Human

HEK293

Tag Free

P34972 (M1-C360)

1269  [NCBI]

Full Length

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Approximately 40.7 kDa

Greater than 95% as determined by HPLC.

Solution

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4. Notice: If you need it for immunization, do not use any adjuvant.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.