1. Recombinant Proteins
  2. Others
  3. Clusterin/APOJ Protein, Mouse (HEK293, His)

Clusterin/APOJ proteins act as extracellular chaperones, inhibiting stress-induced plasma protein aggregation and preventing the formation of amyloid fibrils by various proteins. It maintains partially unfolded proteins in a proper state for refolding by other partners. Clusterin/APOJ Protein, Mouse (HEK293, His) is the recombinant mouse-derived Clusterin/APOJ protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Clusterin/APOJ proteins act as extracellular chaperones, inhibiting stress-induced plasma protein aggregation and preventing the formation of amyloid fibrils by various proteins. It maintains partially unfolded proteins in a proper state for refolding by other partners. Clusterin/APOJ Protein, Mouse (HEK293, His) is the recombinant mouse-derived Clusterin/APOJ protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The Clusterin/APOJ Protein functions as an extracellular chaperone, preventing the aggregation of non-native proteins and inhibiting stress-induced aggregation of blood plasma proteins. It plays a crucial role in inhibiting the formation of amyloid fibrils by various proteins, including APP, APOC2, B2M, CALCA, CSN3, and aggregation-prone LYZ variants in vitro. This chaperone, which does not require ATP, maintains partially unfolded proteins in a state suitable for subsequent refolding by other chaperones like HSPA8/HSC70, although it does not refold proteins independently. Upon binding to cell surface receptors, it triggers internalization of the chaperone-client complex, leading to lysosomal or proteasomal degradation. When secreted, it protects cells against apoptosis and complement-induced cytolysis. Intracellular forms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes, promoting the ubiquitination and proteasomal degradation of target proteins. Clusterin/APOJ also modulates NF-kappa-B transcriptional activity and, following stress, promotes apoptosis. It inhibits apoptosis by interfering with BAX-dependent release of cytochrome c into the cytoplasm when associated with the mitochondrial membrane. Additionally, it plays a role in the regulation of cell proliferation and, when secreted, acts as a modulator during neuronal differentiation through interaction with STMN3. The protein is found in an antiparallel disulfide-linked heterodimer of an alpha chain and a beta chain, self-associates to form higher oligomers, and interacts with a broad range of misfolded proteins, including APP, APOC2, and LYZ. Interactions with various proteins, such as APOA1, LRP2, CLUAP1, PON1, XRCC6, SYVN1, COMMD1, BTRC, CUL1, BAX, HSPA5, BCL2L1, TGFBR2, ACVR1, STMN3, VLDLR, and LRP8, contribute to its diverse functions and regulatory roles.

Biological Activity

Measured by its ability to induce clustering of Caki-2 human clear cell carcinoma epithelial cells.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q06890 (E22-E448)

Gene ID
Molecular Construction
N-term
Clusterin (E22-E448)
Accession # Q06890
6*His
C-term
Synonyms
rMuClusterin/CLU, His ; Clusterin; Apolipoprotein J; Clustrin; Sulfated glycoprotein 2
AA Sequence

EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE

Molecular Weight

Approximately 29-44 & 60-77 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Clusterin/APOJ Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Clusterin/APOJ Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70058
Quantity:
MCE Japan Authorized Agent: