1. Recombinant Proteins
  2. Enzymes & Regulators
  3. CLPS Protein, Rat (HEK293, His)

CLPS protein activates enzymes, regulates catalytic activity, and responds to food.It is located extracellularly and may play a role in type 2 diabetes.CLPS expression is tissue-specific, with a high expression level of RPKM 1512.3.CLPS Protein, Rat (HEK293, His) is the recombinant rat-derived CLPS protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg Get quote
5 μg In-stock
10 μg In-stock
50 μg Get quote
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CLPS protein activates enzymes, regulates catalytic activity, and responds to food.It is located extracellularly and may play a role in type 2 diabetes.CLPS expression is tissue-specific, with a high expression level of RPKM 1512.3.CLPS Protein, Rat (HEK293, His) is the recombinant rat-derived CLPS protein, expressed by HEK293 , with C-His labeled tag.

Background

CLPS, or Colipase, is a protein that enables enzyme activator activity and is involved in positive regulation of catalytic activity, post-embryonic development, and response to food. It is predicted to be located in the extracellular region. The human ortholog(s) of this gene have been implicated in type 2 diabetes mellitus, highlighting its potential role in metabolic regulation. The expression of CLPS is restricted, suggesting specific involvement in certain tissues or physiological contexts, with a notable expression level of RPKM 1512.3.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Rat CLPS at 10μg/mL (100μL/well) can bind Biotinylated Human PNLIP. The ED50 for this effect is 1.817μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Rat CLPS at 10μg/mL (100μL/well) can bind Biotinylated Human PNLIP. The ED50 for this effect is 1.817 μg/mL.
Species

Rat

Source

HEK293

Tag

C-6*His

Accession

NP_037271 (A18-Q112)

Gene ID
Molecular Construction
N-term
CLPS (A18-Q112)
Accession # NP_037271
His
C-term
Synonyms
Colipase; CLPS
AA Sequence

APGPRGLFINLEDGEICVNSMQCKSRCCQHDTILGIARCTHKAMENSECSPKTLYGIYYRCPCERGLTCEGDRSIIGAITNTNYGVCLDSTRSKQ

Molecular Weight

Approximately 12 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CLPS Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CLPS Protein, Rat (HEK293, His)
Cat. No.:
HY-P75334
Quantity:
MCE Japan Authorized Agent: