1. Recombinant Proteins
  2. Others
  3. CLIC3 Protein, Human (His)

The CLIC3 protein is a multifunctional molecule capable of integrating into membranes and forming chloride channels. It has been implicated in potential roles related to cell growth control. CLIC3 Protein, Human (His) is the recombinant human-derived CLIC3 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CLIC3 protein is a multifunctional molecule capable of integrating into membranes and forming chloride channels. It has been implicated in potential roles related to cell growth control. CLIC3 Protein, Human (His) is the recombinant human-derived CLIC3 protein, expressed by E. coli , with C-6*His labeled tag.

Background

CLIC3 protein is a versatile molecule capable of integrating into membranes and forming chloride ion channels. It has been implicated in potential roles related to cellular growth control. Notably, CLIC3 is associated with the C-terminal region of MAPK15, a member of the mitogen-activated protein kinase (MAPK) family. The precise mechanisms and functions of CLIC3 in cellular processes, including growth control and ion channel regulation, require further exploration to fully understand its contributions to normal physiology and disease states.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

O95833 (M1-R236)

Gene ID
Molecular Construction
N-term
CLIC3 (M1-R236)
Accession # O95833
6*His
C-term
Protein Length

Full Length

Synonyms
rHuChloride intracellular channel protein 3/CLIC3, His; Chloride intracellular channel protein 3; CLIC3
AA Sequence

MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR

Molecular Weight

Approximately 31 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 200mM Sucrose, 0.05% Tween 80 (w/v), pH 8.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

CLIC3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CLIC3 Protein, Human (His)
Cat. No.:
HY-P7857
Quantity:
MCE Japan Authorized Agent: