1. Recombinant Proteins
  2. Others
  3. CLIC2/XAP121 Protein, Human (His)

The CLIC2/XAP121 protein exhibits the ability to insert into membranes and form chloride channels, and the activity of these channels is pH-dependent. The membrane insertion process appears to be redox-regulated and likely occurs under oxidative conditions. CLIC2/XAP121 Protein, Human (His) is the recombinant human-derived CLIC2/XAP121 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CLIC2/XAP121 protein exhibits the ability to insert into membranes and form chloride channels, and the activity of these channels is pH-dependent. The membrane insertion process appears to be redox-regulated and likely occurs under oxidative conditions. CLIC2/XAP121 Protein, Human (His) is the recombinant human-derived CLIC2/XAP121 protein, expressed by E. coli , with N-6*His labeled tag.

Background

CLIC2, also known as XAP121, is a versatile protein capable of inserting into membranes and forming chloride ion channels. The activity of these channels is pH-dependent, and membrane insertion is likely regulated by redox conditions, occurring predominantly under oxidizing conditions. Notably, CLIC2 has been found to modulate the activity of RYR2 (ryanodine receptor 2) and inhibit calcium influx, suggesting a role in calcium homeostasis. As a monomer, CLIC2 interacts with TRAPPC2 and RYR2, further emphasizing its potential involvement in diverse cellular processes and protein-protein interactions associated with membrane dynamics, ion channel regulation, and calcium signaling.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

O15247 (M1-S247)

Gene ID
Molecular Construction
N-term
6*His
CLIC2 (M1-S247)
Accession # O15247
C-term
Protein Length

Full Length

Synonyms
rHuChloride intracellular channel protein 2/CLIC2, His; Chloride Intracellular Channel Protein 2; XAP121; CLIC2
AA Sequence

MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS

Molecular Weight

Approximately 32.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CLIC2/XAP121 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CLIC2/XAP121 Protein, Human (His)
Cat. No.:
HY-P7843
Quantity:
MCE Japan Authorized Agent: