CLIC2/XAP121 Protein, Human (His)

The CLIC2/XAP121 protein exhibits the ability to insert into membranes and form chloride channels, and the activity of these channels is pH-dependent. The membrane insertion process appears to be redox-regulated and likely occurs under oxidative conditions. CLIC2/XAP121 Protein, Human (His) is the recombinant human-derived CLIC2/XAP121 protein, expressed by E. coli , with N-6*His labeled tag.

CLIC2, also known as XAP121, is a versatile protein capable of inserting into membranes and forming chloride ion channels. The activity of these channels is pH-dependent, and membrane insertion is likely regulated by redox conditions, occurring predominantly under oxidizing conditions. Notably, CLIC2 has been found to modulate the activity of RYR2 (ryanodine receptor 2) and inhibit calcium influx, suggesting a role in calcium homeostasis. As a monomer, CLIC2 interacts with TRAPPC2 and RYR2, further emphasizing its potential involvement in diverse cellular processes and protein-protein interactions associated with membrane dynamics, ion channel regulation, and calcium signaling.

Human

E. coli

N-6*His

O15247 (M1-S247)

1193  [NCBI]

MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS

Approximately 32.0 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.