1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Dendritic Cell CD Proteins Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. Langerin/CD207
  6. Langerin/CD207 Protein, Human (HEK293, His)

CLC4K protein, a calcium-dependent lectin, promotes antigen uptake. CLC4K is able to bind to sulfated as well as mannosylated glycans, keratan sulfate (KS), and β-glucan. Langerin/CD207 Protein, Human (HEK293, His) is the recombinant human-derived Langerin/CD207 protein, expressed by HEK293 , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CLC4K protein, a calcium-dependent lectin, promotes antigen uptake. CLC4K is able to bind to sulfated as well as mannosylated glycans, keratan sulfate (KS), and β-glucan. Langerin/CD207 Protein, Human (HEK293, His) is the recombinant human-derived Langerin/CD207 protein, expressed by HEK293 , with N-6*His labeled tag.

Background

CLC4K protein, a calcium-dependent lectin encoded by CD207, belongs to the C-type lectin domain family. CLC4K has mannose-binding specificity and is involved in antigen presentation to T cells. CLC4K is the major receptor for Candida, Saccharomyces, and Malassezia furfur on primary Langerhans cells. Langerhans cells are specialized antigen-presenting cells located within the epithelium of the epidermis and mucosa. Upon contact with Langerhans cells, pathogens are captured by the C-type lectin langerin and internalized into structurally unique vesicles called Birbeck granules (BGs). CLC4K induces the formation of Birbeck granules and protects against human immunodeficiency virus 1 (HIV-1) infection. Molecular mechanisms for membrane zipping exist during Birbeck granule biogenesis, and CLC4K is a potent regulator of membrane stacking and zipping. CLC4K binds to high-mannose structures present on the envelope glycoprotein and subsequently targets the virus to Birbeck particles, causing their rapid degradation. Langerhans cell histiocytosis (LCH) is a disorder characterized by clonal expansion of myeloid precursor cells that differentiate into CD1a1/CD207 cells within the lesion. Therefore, detection of clonal tumor proliferation with expression of CD1a, CD207 (Langerin), and S100 can help diagnose LCH.

Species

Human

Source

HEK293

Tag

N-6*His

Accession

AAH22278.1 (Y64-P328)

Gene ID
Molecular Construction
N-term
6*His
Langerin (Y64-P328)
Accession # AAH22278.1
C-term
Protein Length

Partial

Synonyms
rHuC-type lectin domain family 4 member K/CD207, His; CD207 antigen; langerin; CD207; C-type lectin domain family 4 member K; C-type lectin domain family 4, member K
AA Sequence

YPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP

Molecular Weight

30-40 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Langerin/CD207 Protein, Human (HEK293, His)
Cat. No.:
HY-P7819
Quantity:
MCE Japan Authorized Agent: