CLEC14A Protein, Mouse (HEK293, His)

CLEC14A Protein, Mouse (HEK293, His) is the recombinant mouse-derived CLEC14A protein, expressed by HEK293, with C-His labeled tag.

The C-type agglutinin-like receptors (CLECs) family consists of different transmembrane pattern recognition receptors. CLECs play a key role in regulating cancer cell growth, maintaining hemostasis and promoting cell communication. CLEC14A is a type I transmembrane protein belonging to the C-type lectin superfamily that mediates intercellular adhesion, inflammatory response, and apoptosis. CLEC14A contributes to the germination and stability of blood vessels during angiogenesis and the formation of normal lymphatic sacs and blood vessels by regulating the expression levels and signaling of VEGFR-3 and VEGFR-2. CLEC14A is upregulated in hepatocellular carcinoma and may serve as a potential diagnostic biomarker^[1][2][3].

Measured by its binding ability in a functional ELISA. When Recombinant Mouse CLEC14A Protein is immobilized at 1 µg/mL (100 µL/well) can bind Mouse VEGF R3 Protein. The ED₅₀ for this effect is 1.61 μg/mL.

Mouse

HEK293

C-6*His

Q8VCP9 (E22-T386)

66864  [NCBI]

Extracellular Domain

EHPTADRAACSASGACYSLHHATFKRRAAEEACSLRGGTLSTVHSGSEFQAVLLLLRAGPGPGGGSKDLLFWVALERSISQCTQEKEPLRGFSWLHPDSEDSEDSPLPWVEEPQRSCTVRKCAALQATRGVEPAGWKEMRCHLRTDGYLCKYQFEVLCPAPRPGAASNLSFQAPFRLSSSALDFSPPGTEVSAMCPGDLSVSSTCIQEETSAHWDGLFPGTVLCPCSGRYLLAGKCVELPDCLDHLGDFTCECAVGFELGKDGRSCETKVEEQLTLEGTKLPTRNVTATPAGAVTNRTWPGQVYDKPGEMPQVTEILQWGTQSTLPTIQKTPQTKPKVTGTPSGSVVLNYTSSPPVSLTFDTSST

Approximately 70-80 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.