1. Recombinant Proteins
  2. Receptor Proteins
  3. Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. C-Type Lectin Domain Family 10 Member A/CD301
  6. CLEC10A/CD301 Protein, Human (HEK293, His)

CLEC10A/CD301 Protein, implicated in probable immune response regulation, binds Tn-Ag sugar moieties in a calcium-dependent manner. Recognizing these structures on carcinoma cells, CLEC10A/CD301 suggests a role in immune surveillance. Further exploration of its molecular interactions and downstream signaling pathways will enhance understanding of its contributions to immune modulation, especially in the context of cancer immunity. CLEC10A/CD301 Protein, Human (HEK293, His) is the recombinant human-derived CLEC10A/CD301 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CLEC10A/CD301 Protein, implicated in probable immune response regulation, binds Tn-Ag sugar moieties in a calcium-dependent manner. Recognizing these structures on carcinoma cells, CLEC10A/CD301 suggests a role in immune surveillance. Further exploration of its molecular interactions and downstream signaling pathways will enhance understanding of its contributions to immune modulation, especially in the context of cancer immunity. CLEC10A/CD301 Protein, Human (HEK293, His) is the recombinant human-derived CLEC10A/CD301 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The CLEC10A/CD301 protein is implicated in the probable regulation of adaptive and innate immune responses. Functioning in a calcium-dependent manner, it binds to terminal galactose and N-acetylgalactosamine units, specifically those linked to serine or threonine. These sugar moieties, known as Tn-Ag, are expressed in various carcinoma cells. The involvement of CLEC10A/CD301 in recognizing and binding to these specific carbohydrate structures suggests a potential role in immune surveillance, particularly in the context of carcinoma cells. Further exploration of the molecular interactions and downstream signaling pathways influenced by CLEC10A/CD301 will enhance our understanding of its contributions to immune modulation and its potential implications in cancer immunity.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q8IUN9 (Q61-H316)

Gene ID
Molecular Construction
N-term
CLEC10A (Q61-H316)
Accession # Q8IUN9
6*His
C-term
Synonyms
C-type lectin domain family 10 member A; CD301; CLEC10A; CLECSF13; CLECSF14; HML
AA Sequence

QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH

Molecular Weight

Approximately 40 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CLEC10A/CD301 Protein, Human (HEK293, His)
Cat. No.:
HY-P72689
Quantity:
MCE Japan Authorized Agent: