cIAP1/BIRC2 Protein, Human (Avi)

cIAP1/BIRC2 Protein, Human (Avi) is the recombinant human-derived cIAP1/BIRC2 protein, expressed by E. coli, with C-Avi tag.

cIAP1/BIRC2 is a multi-functional protein that regulates not only caspases and apoptosis but also modulates inflammatory signaling and immunity, mitogenic kinase signaling, cell proliferation, as well as cell invasion and metastasis. It acts as an E3 ubiquitin-protein ligase regulating NF-kappa-B signaling and controls both canonical and non-canonical NF-kappa-B signaling in opposite directions: promoting the canonical pathway while suppressing constitutive activation of the non-canonical pathway. Its E3 ubiquitin-protein ligase targets include RIPK1, RIPK2, RIPK3, RIPK4, CASP3, CASP7, CASP8, TRAF2, DIABLO/SMAC, MAP3K14/NIK, MAP3K5/ASK1, IKBKG/NEMO, IKBKE, and MXD1/MAD1. Additionally, it functions as an E3 ligase in the NEDD8 conjugation pathway, neddylating and inactivating effector caspases. It plays a critical role in innate immune signaling by regulating pattern recognition receptors (PRRs) such as Toll-like receptors (TLRs), Nod-like receptors (NLRs), and RIG-I-like receptors (RLRs). It protects cells from spontaneous ripoptosome formation, a pro-death multi-protein complex capable of killing cancer cells via caspase-dependent and -independent mechanisms, by ubiquitinating RIPK1 and CASP8. It also stimulates E2F1 transcriptional activity and contributes to cell cycle modulation.

Human

E. coli

C-Avi

NP_001157.1 (N-G&P, E144-L356)

329

Partial

EHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLL

Approximately 26.5 kDa,based on SDS-PAGE under reducing conditions.

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.