CHRNA7 Protein, Human (His)

CHRNA7 Protein, Human (His) is the recombinant human-derived CHRNA7 protein, expressed by E. coli, with N-6*His tag.

CHRNA7 is a component of neuronal acetylcholine receptors (nAChRs), which function as pentameric, ligand-gated cation channels with high calcium permeability among other activities. nAChRs are excitatory neurotransmitter receptors formed by a collection of nAChR subunits known to mediate synaptic transmission in the nervous system and the neuromuscular junction. Each nAChR subunit confers differential attributes to channel properties, including activation, deactivation and desensitization kinetics, pH sensitivity, cation permeability, and binding to allosteric modulators. CHRNA7 forms homopentameric neuronal acetylcholine receptors abundantly expressed in the central nervous system, characterized by fast desensitization and high calcium permeability. It also forms heteropentamers with CHRNB2, mainly expressed in basal forebrain cholinergic neurons. It is involved in the modulation of calcium-dependent signaling pathways and influences the release of neurotransmitters, including dopamine, glutamate, and GABA. CHRNA7 is also expressed in non-neuronal cells such as immune cells like lymphocytes, monocytes, and macrophages. In T cells, activation induces metabotropic signaling that results in an increase of intracellular Ca2+ concentrations, independent of ionotropic receptor functions. In macrophages, it is required for acetylcholine-mediated inhibition of TNF and other inflammatory cytokine release. Once activated by acetylcholine, nicotine, or other agonists, it selectively inhibits the production of pro-inflammatory cytokines while leaving anti-inflammatory cytokines undisturbed. It stimulates the cholinergic anti-inflammatory pathway, controlling inflammation by inhibiting NFKB nuclear translocation and activating the JAK2-STAT3 pathway, independently of ion channel activity. Additionally, it is expressed in the urothelium, where it modulates reflex bladder activity by increasing intracellular calcium through internal stores and decreasing basal ATP release (by similar).

Human

E. coli

N-6*His

P36544-1 (G23-T230)

1139/89832

Extracellular Domain

GEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRT

Approximately 32 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.