1. Recombinant Proteins
  2. Receptor Proteins
  3. CHRNA3 Protein, Human (His-SUMO)

CHRNA3 Protein, a critical contributor to collagen fibrillogenesis, regulates the rate of fibril formation and influences the assembly and organization of collagen fibrils. Binding to both type I and type II collagen, CHRNA3 plays a pivotal role in shaping the structural integrity of the extracellular matrix. CHRNA3 Protein, Human (His-SUMO) is the recombinant human-derived CHRNA3 protein, expressed by E. coli , with N-10*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CHRNA3 Protein, a critical contributor to collagen fibrillogenesis, regulates the rate of fibril formation and influences the assembly and organization of collagen fibrils. Binding to both type I and type II collagen, CHRNA3 plays a pivotal role in shaping the structural integrity of the extracellular matrix. CHRNA3 Protein, Human (His-SUMO) is the recombinant human-derived CHRNA3 protein, expressed by E. coli , with N-10*His, N-SUMO labeled tag.

Background

Fibromodulin, a protein with a pivotal role in collagen fibrillogenesis, significantly influences the rate of fibril formation and may serve as a primary contributor to this process. Known to bind both type I and type II collagen, Fibromodulin plays a crucial role in modulating the assembly and organization of collagen fibrils. Its impact on the dynamics of fibrillogenesis suggests its involvement in shaping the structural integrity of the extracellular matrix.

Species

Human

Source

E. coli

Tag

N-10*His;N-SUMO

Accession

P32297 (S32-L240)

Gene ID
Molecular Construction
N-term
10*His-SUMO
CHRNA3 (S32-L240)
Accession # P32297
C-term
Protein Length

Partial

Synonyms
ACHA3_HUMAN; AChR; Cholinergic receptor neuronal nicotinic alpha polypeptide 3; Cholinergic receptor nicotinic alpha 3; Cholinergic receptor nicotinic alpha polypeptide 3; CHRNA 3; CHRNA3; LNCR2; MGC104879; NACHRA 3; NACHRA3; Neuronal acetylcholine receptor protein alpha 3 chain precursor; Neuronal acetylcholine receptor subunit alpha 3; Neuronal acetylcholine receptor subunit alpha-3; Neuronal nicotinic acetylcholine receptor alpha 3 subunit; PAOD2
AA Sequence

SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL

Molecular Weight

Approximately 44.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CHRNA3 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CHRNA3 Protein, Human (His-SUMO)
Cat. No.:
HY-P72144
Quantity:
MCE Japan Authorized Agent: