1. Recombinant Proteins
  2. Others
  3. Chemotaxis inhibitory Protein, S. aureus (P.pastoris, His)

Chemotaxis inhibitory Protein, S. aureus (P.pastoris, His)

Cat. No.: HY-P71834
Handling Instructions Technical Support

Chemotaxis Inhibitory Protein (CIP) strategically counters the host defense mechanisms, inhibiting reactions of human neutrophils and monocytes to complement anaphylatoxin C5a and fMLP. As a molecular sentinel, CIP directly engages with C5aR and FPR, obstructing calcium responses induced by C5a and fMLP. In this tactical intervention, CIP acts as a guardian, finessefully thwarting bacterium phagocytosis. Chemotaxis inhibitory Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Chemotaxis inhibitory protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Chemotaxis Inhibitory Protein (CIP) strategically counters the host defense mechanisms, inhibiting reactions of human neutrophils and monocytes to complement anaphylatoxin C5a and fMLP. As a molecular sentinel, CIP directly engages with C5aR and FPR, obstructing calcium responses induced by C5a and fMLP. In this tactical intervention, CIP acts as a guardian, finessefully thwarting bacterium phagocytosis. Chemotaxis inhibitory Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Chemotaxis inhibitory protein, expressed by P. pastoris , with N-His labeled tag.

Background

Chemotaxis Inhibitory Protein (CIP) strategically navigates the realm of host defense mechanisms, specifically countering the initial lines of immune response. Its role unfolds in inhibiting the reactions of human neutrophils and monocytes to the complement anaphylatoxin C5a and formylated peptides, such as N-formyl-methionyl-leucyl-phenylalanine (fMLP). Functioning as a molecular sentinel, CIP directly engages with the C5a receptor (C5aR) and formylated peptide receptor (FPR), effectively obstructing the calcium responses induced by C5a and fMLP. In this tactical intervention, CIP acts as a guardian, thwarting the phagocytosis of the bacterium with finesse.

Species

Staphylococcus aureus

Source

P. pastoris

Tag

N-His

Accession

Q6GFB3 (F29-Y149)

Gene ID

/

Molecular Construction
N-term
His
Chemotaxis inhibitory (F29-Y149)
Accession # Q6GFB3
C-term
Protein Length

Full Length of Mature Protein

Synonyms
chp; SAR2036Chemotaxis inhibitory protein; CHIPS
AA Sequence

FTFEPFPTNEEIESNKKMLEKEKAYKESFKNSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY

Predicted Molecular Mass
16.1 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Chemotaxis inhibitory Protein, S. aureus (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Chemotaxis inhibitory Protein, S. aureus (P.pastoris, His)
Cat. No.:
HY-P71834
Quantity:
MCE Japan Authorized Agent: