1. Recombinant Proteins
  2. Others
  3. Centrin-2 Protein, Human (His)

Centrin-2 protein plays a critical role in microtubule-organized centromere structure, directing centriole duplication, spindle formation, and regulation of cytokinesis. It ensures genome stability by interacting with CALM1 and CCP110. Centrin-2 Protein, Human (His) is the recombinant human-derived Centrin-2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Centrin-2 protein plays a critical role in microtubule-organized centromere structure, directing centriole duplication, spindle formation, and regulation of cytokinesis. It ensures genome stability by interacting with CALM1 and CCP110. Centrin-2 Protein, Human (His) is the recombinant human-derived Centrin-2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

Centrin-2 Protein assumes a fundamental role in the structure and function of the microtubule organizing center, particularly in centriole duplication and the proper formation of spindles during cell division. Beyond its central role in these processes, Centrin-2 contributes to the regulation of cytokinesis and maintenance of genome stability through collaborative interactions with CALM1 and CCP110. Additionally, it is intricately involved in global genome nucleotide excision repair (GG-NER) by acting as a crucial component of the XPC complex. In partnership with RAD23B, Centrin-2 appears to stabilize XPC, and in vitro, it stimulates the DNA binding of the XPC:RAD23B dimer, highlighting its multifaceted involvement in cellular mechanisms essential for genomic integrity and cell division.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P41208 (A2-Y172)

Gene ID
Molecular Construction
N-term
6*His
Centrin-2 (A2-Y172)
Accession # P41208
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Centrin-2; Caltractin isoform 1; CETN2; CALT; CEN2
AA Sequence

ASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY

Molecular Weight

Approximately 20 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Centrin-2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Centrin-2 Protein, Human (His)
Cat. No.:
HY-P75351
Quantity:
MCE Japan Authorized Agent: