1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Stem Cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. CEACAM8/NCA-95/CD66b Immunoglobulin-like Cell Adhesion Molecules
  5. CEACAM8/NCA-95/CD66b
  6. CEACAM8/CD66b Protein, Human (His-SUMO)

CEACAM8/CD66b protein is a cell surface glycoprotein that promotes calcium-independent heterophil cell adhesion to other carcinoembryonic antigen-related cell adhesion molecules, particularly CEACAM6, in activated neutrophils Especially obvious. CEACAM8/CD66b Protein, Human (His-SUMO) is the recombinant human-derived CEACAM8/CD66b protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CEACAM8/CD66b protein is a cell surface glycoprotein that promotes calcium-independent heterophil cell adhesion to other carcinoembryonic antigen-related cell adhesion molecules, particularly CEACAM6, in activated neutrophils Especially obvious. CEACAM8/CD66b Protein, Human (His-SUMO) is the recombinant human-derived CEACAM8/CD66b protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

CEACAM8/CD66b protein, a cell surface glycoprotein, actively contributes to cell adhesion in a calcium-independent manner. It primarily mediates heterophilic cell adhesion, forming interactions with other carcinoembryonic antigen-related cell adhesion molecules, including CEACAM6. Notably, the heterophilic interaction with CEACAM8 takes place specifically in activated neutrophils. CEACAM8 operates as a monomer and also forms heterodimers with CEACAM6, engaging in heterodimerization through its Ig-like V-type domain. This emphasizes its role as a versatile cell adhesion molecule, participating in interactions with various partners and highlighting its significance in diverse cellular contexts, particularly in activated neutrophils and during heterophilic adhesion with other CEACAM family members.

Species

Human

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

P31997 (Q35-D320)

Gene ID
Molecular Construction
N-term
6*His-SUMO
CEACAM8 (Q35-D320)
Accession # P31997
C-term
Synonyms
Carcinoembryonic antigen CGM6; Carcinoembryonic antigen gene family member 6; Carcinoembryonic antigen related cell adhesion molecule 8; Carcinoembryonic antigen-related cell adhesion molecule 8; CD 66b; CD 67; CD66b; CD66b antigen; CD67; CD67 antigen; CEACAM 8; CEACAM8; CEAM8_HUMAN; CGM 6; CGM6; NCA 95; NCA95; Non-specific cross-reacting antigen NCA-95; Nonspecific cross reacting antigen NCA 95; Nonspecific cross reacting antigen NCA95
AA Sequence

QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD

Molecular Weight

Approximately 47.5 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CEACAM8/CD66b Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CEACAM8/CD66b Protein, Human (His-SUMO)
Cat. No.:
HY-P72133
Quantity:
MCE Japan Authorized Agent: