2. Recombinant Proteins
  3. Receptor Proteins
  4. Cell Adhesion Molecules (CAMs)
  5. Immunoglobulin-like Cell Adhesion Molecules
  6. CEA Cell Adhesion Molecule 7 (CEACAM7)
  7. CEACAM7 Protein, Human (His-SUMO)

Carcinoembryonic antigen-related cell adhesion molecule 7 is a member of the CEA family, a large group of proteins with diverse roles, and which are typically dysregulated in malignancies. Carcinoembryonic antigen-related cell adhesion molecule 7 is a GPI-anchored protein with no intracellular domain and a relatively small extracellular domain. CEACAM7 Protein, Human (His-SUMO) is the recombinant human-derived CEACAM7 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Carcinoembryonic antigen-related cell adhesion molecule 7 is a member of the CEA family, a large group of proteins with diverse roles, and which are typically dysregulated in malignancies. Carcinoembryonic antigen-related cell adhesion molecule 7 is a GPI-anchored protein with no intracellular domain and a relatively small extracellular domain. CEACAM7 Protein, Human (His-SUMO) is the recombinant human-derived CEACAM7 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
Background

Carcinoembryonic antigen-related cell adhesion molecule 7 encodes a cell surface glycoprotein and member of the carcinoembryonic antigen (CEA) family of proteins. Expression of this gene may be downregulated in colon and rectal cancer. Carcinoembryonic antigen-related cell adhesion molecule 7 with lower expression levels may be predictive of rectal cancer recurrence. Carcinoembryonic antigen-related cell adhesion molecule 7 is present in a CEA family gene cluster on chromosome 19[1][2][3].
Species

Human
Source

E. coli
Tag

N-6*His;N-SUMO
Accession

Q14002 (T36-S242)
Gene ID
Molecular Construction
N-term
6*His-SUMO
CEACAM7 (T36-S242)
Accession # Q14002
C-term
Protein Length

Full Length of Mature Protein
Synonyms
Carcinoembryonic antigen CGM 2; Carcinoembryonic antigen CGM2; Carcinoembryonic antigen gene family member 2; Carcinoembryonic antigen related cell adhesion molecule 7; Carcinoembryonic antigen-related cell adhesion molecule 7; CEA; CEACAM 7; CEACAM7; CEAM7_HUMAN; CGM 2; CGM2
AA Sequence

TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS

Predicted Molecular Mass
39.4 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

CEACAM7 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CEACAM7 Protein, Human (His-SUMO)
Cat. No.:
HY-P72132
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.