2. Recombinant Proteins
  3. CD Antigens Receptor Proteins Biotinylated Proteins
  4. Stem Cell CD Proteins Epithelial cell CD Proteins Cell Adhesion Molecules (CAMs)
  5. CD66c/CEACAM6 Immunoglobulin-like Cell Adhesion Molecules
  6. CD66c/CEACAM6
  7. CEACAM6 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

CEACAM6 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P704145
Handling Instructions Technical Support

CEACAM6 Protein, Cynomolgus (Biotinylated, HEK293, His, Avi) is the recombinant cynomolgus-derived CEACAM6 protein, expressed by HEK293, with C-His & C-Avi tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CEACAM6 Protein, Cynomolgus (Biotinylated, HEK293, His, Avi) is the recombinant cynomolgus-derived CEACAM6 protein, expressed by HEK293, with C-His & C-Avi tag.
Background

CEACAM6 protein, a cell surface glycoprotein, assumes a pivotal role in cell adhesion and tumor progression. Interactions occur in a calcium- and fibronectin-independent manner, mediating both homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules like CEACAM5 and CEACAM8. Particularly, heterophilic interaction with CEACAM8 takes place in activated neutrophils, influencing neutrophil adhesion to cytokine-activated endothelial cells. In the context of tumor progression, CEACAM6 operates as an oncogene by positively regulating cell migration, adhesion to endothelial cells, and invasion. Additionally, it contributes to the metastatic cascade by inducing resistance to anoikis in pancreatic adenocarcinoma and colorectal carcinoma cells. CEACAM6 forms homodimers, engaging in homodimerization via its Ig-like V-type domain, and also forms heterodimers with CEACAM8 through their respective Ig-like V-type domains, highlighting its multifaceted role in cell adhesion and cancer-related processes.
Species

Cynomolgus
Source

HEK293
Tag

C-Avi;C-8*His
Accession

XP_005589488.3 (Q35-G320)
Gene ID

135964351
Molecular Construction
N-term
(Q35-G320)
Accession # XP_005589488.3
8*His
Avi
C-term
Protein Length

Partial
Synonyms
Carcinoembryonic antigen related cell adhesion molecule 6 ; Carcinoembryonic antigen related cell adhesion molecule 6 non specific cross reacting antigen; Carcinoembryonic antigen-related cell adhesion molecule 6; CD 66c; CD66c; CD66c antigen; CEA LIKE PROTEIN; CEACAM 6; CEACAM6; CEAL; CEAM6_HUMAN; MGC93832; NCA; Non specific cross reacting antigen; Non-specific crossreacting antigen; Normal cross reacting antigen; Normal cross-reacting antigen
AA Sequence

QLTIESRPFAVNEGKEVLLLAHNLPQNLIGFNWYKGERVDAKRLIVAYVIGTQQTTPGPAHSGREMIYSNASLLIQNVTQNDTGSYTLQVIKGDLVNEEATGRFWVYPELPKPYITSNNSNPVEDKDAVDFTCEPDIHSTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVKRNDAGAYECEIQNPVSANFSDPVILNVLYGPDVPTISPSNSNYRPGENLNLSCHAASNPTAQYSWFVNGTFQQSTQELFIPNITVNNSGSYMCQAYNSATGLNRTTVMMITVSG

Predicted Molecular Mass
34.5 kDa
Molecular Weight

Approximately 60-80 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.
Purity

Greater than 95% as determined by Bis-Tris PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

CEACAM6 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CEACAM6 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P704145
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.