1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Stem Cell CD Proteins Epithelial cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. CD66e/CEACAM5 Immunoglobulin-like Cell Adhesion Molecules
  5. CD66e/CEACAM5
  6. CEACAM5 Protein, Human (HEK293, His)

CEACAM5 protein is a cell surface glycoprotein that cooperates with carcinoembryonic antigen-related molecules (such as CEACAM6) to participate in cell adhesion, intracellular signaling, and tumor progression. CEACAM5 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM5 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE CEACAM5 Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CEACAM5 protein is a cell surface glycoprotein that cooperates with carcinoembryonic antigen-related molecules (such as CEACAM6) to participate in cell adhesion, intracellular signaling, and tumor progression. CEACAM5 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM5 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CEACAM5 protein, a cell surface glycoprotein, assumes a multifaceted role in cell adhesion, intracellular signaling, and tumor progression. Functioning as a mediator of both homophilic and heterophilic cell adhesion, CEACAM5 interacts with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. In the context of tumor progression, CEACAM5 acts as an oncogene, promoting tumor advancement and inducing resistance to anoikis in colorectal carcinoma cells. Additionally, during microbial infection, CEACAM5 serves as a receptor for E. coli Dr adhesins, and the binding of these adhesins results in the dissociation of the CEACAM5 homodimer. These diverse functions underscore the versatility of CEACAM5 in regulating cellular processes and highlight its significance in both physiological and pathological contexts.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Galectin-4 protein (HY-P72638) at 2 μg/mL (100 μL/well) can bind CEACAM5. The Kd for this effect is 3.123 nM.

  • Measured by its binding ability in a functional ELISA. Immobilized Galectin-4 protein (HY-P72638) at 2 μg/mL (100 μL/well) can bind CEACAM5. The Kd for this effect is 3.123 nM.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

P06731-1 (K35-A685)

Gene ID
Molecular Construction
N-term
CEACAM5 (K35-A685)
Accession # P06731-1
6*His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Carcinoembryonic antigen-related cell adhesion molecule 5; Carcinoembryonic antigen; CEA; Meconium antigen 100; CD66e; CEACAM5
AA Sequence

KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

Molecular Weight

95-150 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CEACAM5 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CEACAM5 Protein, Human (HEK293, His)
Cat. No.:
HY-P70675
Quantity:
MCE Japan Authorized Agent: