1. Recombinant Proteins
  2. Receptor Proteins
  3. Cell Adhesion Molecules (CAMs)
  4. Immunoglobulin-like Cell Adhesion Molecules
  5. CEA Cell Adhesion Molecule 21
  6. CEACAM21 Protein, Human (HEK293, His)

CEA21/CEACAM21, a carcinoembryonic antigen (CEA)-related cell adhesion molecule, is expressed on granulocytes. CEACAM21 is also a biological candidate gene for schizophrenia and type I diabetes, with SNPs consistently associated with the disease. CEACAM21 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM21 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CEA21/CEACAM21, a carcinoembryonic antigen (CEA)-related cell adhesion molecule, is expressed on granulocytes. CEACAM21 is also a biological candidate gene for schizophrenia and type I diabetes, with SNPs consistently associated with the disease. CEACAM21 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM21 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CEA21/CEACAM21, a carcinoembryonic antigen (CEA)-related cell adhesion molecule, is expressed by CEACAM21. CEA21 may be a component of membranes and is widely expressed in tissues such as bone marrow and lymph nodes. CEA21 is an innate immune receptor expressed on granulocytes and targets specific human pathogens. CEACAM21 is also a biologically plausible candidate gene for schizophrenia. CEACAM21 contains a predicted intron (a region containing a large number of human spliced ESTs and mRNAs) with SNPs consistently associated with increased risk of schizophrenia. CEACAM21 is also a Type I Diabetes Genetics Consortium candidate gene with significant association.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q3KPI0-1/AAI06728.1 (W35-G240)

Gene ID
Molecular Construction
N-term
CEACAM21 (W35-G240)
Accession # Q3KPI0-1/AAI06728.1
6*His
C-term
Synonyms
rHuCarcinoembryonic antigen-related cell adhesion molecule 21/CEACAM21, His; Carcinoembryonic antigen-related cell adhesion molecule 21; CEACAM21
AA Sequence

WLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYTLQVTYRNSQIEQASHHLRVYESVAQPSIQASSTTVTEKGSVVLTCHTNNTGTSFQWIFNNQRLQVTKRMKLSWFNHMLTIDPIRQEDAGEYQCEVSNPVSSNRSDPLKLTVKSDDNTLG

Molecular Weight

Approximately 35.0 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CEACAM21 Protein, Human (HEK293, His)
Cat. No.:
HY-P7823
Quantity:
MCE Japan Authorized Agent: